Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2NCM1

Protein Details
Accession M2NCM1    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
85-115TTAKRTDSEKKPRSNRIRKPRKPRNNIVFAPHydrophilic
NLS Segment(s)
PositionSequence
92-108SEKKPRSNRIRKPRKPR
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG bcom:BAUCODRAFT_147125  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSARASRVKTNNTALRKKVFGPVETARNKRLNAKLLELAQQAKPQRSEMDVVPDSAEQKDAEKAEPQATAEGKMEVDEGAGATTAKRTDSEKKPRSNRIRKPRKPRNNIVFAPTASTPEAYQPVIPEVAYMFATFLGHTSTSRAVTRESEQDWYEDTNDSCTNNALKLLPRRHHDAEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.73
3 0.69
4 0.64
5 0.6
6 0.56
7 0.55
8 0.51
9 0.43
10 0.42
11 0.42
12 0.46
13 0.51
14 0.53
15 0.51
16 0.52
17 0.52
18 0.53
19 0.54
20 0.52
21 0.48
22 0.49
23 0.47
24 0.44
25 0.47
26 0.41
27 0.37
28 0.31
29 0.33
30 0.32
31 0.31
32 0.3
33 0.27
34 0.27
35 0.26
36 0.27
37 0.22
38 0.27
39 0.24
40 0.23
41 0.22
42 0.21
43 0.2
44 0.18
45 0.18
46 0.09
47 0.1
48 0.13
49 0.13
50 0.13
51 0.14
52 0.16
53 0.16
54 0.17
55 0.16
56 0.16
57 0.15
58 0.16
59 0.14
60 0.12
61 0.11
62 0.1
63 0.1
64 0.07
65 0.06
66 0.04
67 0.04
68 0.03
69 0.04
70 0.03
71 0.03
72 0.04
73 0.04
74 0.05
75 0.06
76 0.09
77 0.17
78 0.26
79 0.38
80 0.44
81 0.53
82 0.6
83 0.7
84 0.78
85 0.8
86 0.81
87 0.81
88 0.86
89 0.86
90 0.9
91 0.91
92 0.91
93 0.9
94 0.9
95 0.88
96 0.86
97 0.78
98 0.71
99 0.63
100 0.52
101 0.46
102 0.36
103 0.28
104 0.19
105 0.18
106 0.14
107 0.12
108 0.14
109 0.12
110 0.12
111 0.11
112 0.12
113 0.12
114 0.11
115 0.09
116 0.07
117 0.08
118 0.08
119 0.07
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.07
126 0.07
127 0.07
128 0.1
129 0.12
130 0.14
131 0.16
132 0.16
133 0.17
134 0.2
135 0.23
136 0.26
137 0.26
138 0.28
139 0.27
140 0.28
141 0.27
142 0.26
143 0.24
144 0.21
145 0.19
146 0.2
147 0.21
148 0.2
149 0.19
150 0.19
151 0.19
152 0.17
153 0.19
154 0.17
155 0.23
156 0.32
157 0.4
158 0.45
159 0.49
160 0.56