Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2NAW4

Protein Details
Accession M2NAW4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
272-297AIAVVAFLKKKKKNEREKANVPEVSQHydrophilic
NLS Segment(s)
PositionSequence
280-287KKKKKNER
Subcellular Location(s) extr 24, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG bcom:BAUCODRAFT_511434  -  
Amino Acid Sequences MAKILRVAFAELALAHIARSYLIPLASHTAFIEDAPDVDGWTPRPTQAPYAQYFELSDHRNLLARQAGLATCGYLAGNASLPITCDAGYGCGYNSPVPYGPICCSTNAAGNFVSNCPYPSSCVDYANPLNTFLVETTSNGQLWCPSSLPYCSTAYEPMATTYFLYWCASASGAAALTILPSTTAVATGHPTSLSSPRSSTVVSSTSSTPIVRSSTTLSITSSSSPVVVLPSSSHGTSPTPPPTPTPTPNPTNAGAIAGGVVGGVAAVGIIAAIAVVAFLKKKKKNEREKANVPEVSQANI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.08
4 0.08
5 0.07
6 0.08
7 0.08
8 0.09
9 0.1
10 0.1
11 0.12
12 0.17
13 0.17
14 0.17
15 0.16
16 0.15
17 0.15
18 0.15
19 0.15
20 0.09
21 0.09
22 0.1
23 0.1
24 0.09
25 0.1
26 0.12
27 0.12
28 0.15
29 0.15
30 0.15
31 0.19
32 0.2
33 0.25
34 0.3
35 0.35
36 0.35
37 0.4
38 0.39
39 0.35
40 0.34
41 0.31
42 0.29
43 0.26
44 0.24
45 0.2
46 0.21
47 0.23
48 0.23
49 0.24
50 0.23
51 0.19
52 0.18
53 0.18
54 0.18
55 0.16
56 0.16
57 0.12
58 0.08
59 0.08
60 0.07
61 0.06
62 0.06
63 0.05
64 0.06
65 0.06
66 0.06
67 0.06
68 0.07
69 0.08
70 0.08
71 0.08
72 0.07
73 0.07
74 0.08
75 0.09
76 0.08
77 0.08
78 0.08
79 0.09
80 0.1
81 0.1
82 0.11
83 0.1
84 0.11
85 0.12
86 0.13
87 0.13
88 0.17
89 0.17
90 0.16
91 0.18
92 0.17
93 0.22
94 0.2
95 0.21
96 0.16
97 0.16
98 0.17
99 0.15
100 0.16
101 0.11
102 0.11
103 0.11
104 0.11
105 0.13
106 0.14
107 0.19
108 0.18
109 0.2
110 0.2
111 0.23
112 0.24
113 0.25
114 0.23
115 0.18
116 0.17
117 0.15
118 0.15
119 0.1
120 0.1
121 0.07
122 0.08
123 0.09
124 0.1
125 0.1
126 0.1
127 0.1
128 0.09
129 0.1
130 0.1
131 0.09
132 0.09
133 0.1
134 0.11
135 0.12
136 0.13
137 0.13
138 0.13
139 0.13
140 0.14
141 0.13
142 0.13
143 0.12
144 0.11
145 0.1
146 0.09
147 0.09
148 0.08
149 0.08
150 0.08
151 0.08
152 0.07
153 0.06
154 0.07
155 0.06
156 0.06
157 0.06
158 0.05
159 0.04
160 0.04
161 0.04
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.04
171 0.04
172 0.05
173 0.07
174 0.08
175 0.08
176 0.08
177 0.08
178 0.09
179 0.14
180 0.15
181 0.14
182 0.15
183 0.16
184 0.17
185 0.17
186 0.16
187 0.15
188 0.15
189 0.15
190 0.16
191 0.16
192 0.16
193 0.17
194 0.16
195 0.14
196 0.14
197 0.14
198 0.13
199 0.13
200 0.15
201 0.17
202 0.19
203 0.19
204 0.18
205 0.18
206 0.18
207 0.18
208 0.15
209 0.12
210 0.1
211 0.1
212 0.09
213 0.09
214 0.08
215 0.07
216 0.07
217 0.11
218 0.13
219 0.13
220 0.13
221 0.14
222 0.16
223 0.18
224 0.24
225 0.26
226 0.27
227 0.28
228 0.31
229 0.37
230 0.42
231 0.44
232 0.46
233 0.47
234 0.49
235 0.52
236 0.53
237 0.47
238 0.42
239 0.37
240 0.3
241 0.23
242 0.18
243 0.14
244 0.09
245 0.07
246 0.04
247 0.04
248 0.02
249 0.02
250 0.02
251 0.01
252 0.01
253 0.01
254 0.01
255 0.01
256 0.01
257 0.01
258 0.01
259 0.01
260 0.01
261 0.02
262 0.02
263 0.03
264 0.06
265 0.11
266 0.21
267 0.28
268 0.39
269 0.5
270 0.61
271 0.72
272 0.8
273 0.87
274 0.88
275 0.92
276 0.91
277 0.89
278 0.82
279 0.71
280 0.68