Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2M255

Protein Details
Accession M2M255   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
326-345RRLPKAFRRKLYFQYKKKFGBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9, nucl 8.5, cyto 8.5, pero 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR015222  Tam41  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0004605  F:phosphatidate cytidylyltransferase activity  
GO:0032049  P:cardiolipin biosynthetic process  
GO:0016024  P:CDP-diacylglycerol biosynthetic process  
KEGG bcom:BAUCODRAFT_62313  -  
Pfam View protein in Pfam  
PF09139  Tam41_Mmp37  
Amino Acid Sequences WEDDPNYQITAFSELPHRYFGHNQHIRVNEDFKESLRQILWRFRAPIRYAFAYGSGVFAQQSSKSMTETSMSPHPNPPKAVEDWQKGGAKIIDFIFGVSHTQHWHSLNLMEHPDHYSFLRHLPYSSAAISHIQDDFGAGVYFNPYITVNGTMIKYGVVNLDTLSRDLSEWNTLYLAGRLQKPVKILRDDPRIRLANQVNLISALRTALLMLPEKFSERQLYERIAGLSYTGDPRMNPLFASENPNKISNIVGAQLPGFRQLYVPLIENLPNVHFSDPRTPRDHAWEKEDAIRHTGTNPQLDNVLGGADGLELEQNMDPVPRGNMVRRLPKAFRRKLYFQYKKKFGIPGAAFTDVLEASEDEDATSMRKREGGDFERRIAAEADLPETVGRCVRNTVGWPSTTQSIKGVFTSGFAKSWKYLGEKRSKGKRSTLSVGSAADGKAEGKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.3
4 0.31
5 0.29
6 0.37
7 0.42
8 0.46
9 0.5
10 0.51
11 0.55
12 0.58
13 0.57
14 0.54
15 0.52
16 0.43
17 0.42
18 0.41
19 0.35
20 0.38
21 0.34
22 0.34
23 0.32
24 0.34
25 0.34
26 0.42
27 0.46
28 0.43
29 0.48
30 0.47
31 0.54
32 0.53
33 0.54
34 0.51
35 0.49
36 0.45
37 0.41
38 0.38
39 0.32
40 0.29
41 0.24
42 0.18
43 0.15
44 0.13
45 0.12
46 0.12
47 0.1
48 0.13
49 0.14
50 0.15
51 0.15
52 0.16
53 0.17
54 0.17
55 0.17
56 0.19
57 0.24
58 0.26
59 0.28
60 0.35
61 0.41
62 0.44
63 0.46
64 0.45
65 0.42
66 0.43
67 0.49
68 0.5
69 0.48
70 0.46
71 0.51
72 0.5
73 0.45
74 0.43
75 0.37
76 0.29
77 0.26
78 0.23
79 0.18
80 0.16
81 0.16
82 0.13
83 0.11
84 0.12
85 0.1
86 0.1
87 0.1
88 0.13
89 0.16
90 0.17
91 0.18
92 0.18
93 0.21
94 0.22
95 0.23
96 0.24
97 0.21
98 0.2
99 0.22
100 0.22
101 0.19
102 0.18
103 0.17
104 0.15
105 0.19
106 0.21
107 0.19
108 0.19
109 0.2
110 0.21
111 0.21
112 0.2
113 0.17
114 0.14
115 0.16
116 0.16
117 0.15
118 0.13
119 0.11
120 0.1
121 0.1
122 0.09
123 0.07
124 0.07
125 0.05
126 0.05
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.07
133 0.08
134 0.09
135 0.08
136 0.11
137 0.11
138 0.1
139 0.1
140 0.1
141 0.09
142 0.08
143 0.08
144 0.06
145 0.06
146 0.07
147 0.09
148 0.09
149 0.1
150 0.09
151 0.08
152 0.08
153 0.09
154 0.1
155 0.11
156 0.1
157 0.11
158 0.1
159 0.1
160 0.1
161 0.1
162 0.11
163 0.11
164 0.13
165 0.16
166 0.17
167 0.19
168 0.22
169 0.27
170 0.29
171 0.3
172 0.34
173 0.39
174 0.48
175 0.49
176 0.48
177 0.5
178 0.47
179 0.44
180 0.46
181 0.4
182 0.34
183 0.34
184 0.32
185 0.24
186 0.23
187 0.22
188 0.14
189 0.12
190 0.07
191 0.05
192 0.04
193 0.05
194 0.04
195 0.06
196 0.08
197 0.08
198 0.09
199 0.09
200 0.11
201 0.11
202 0.12
203 0.14
204 0.13
205 0.15
206 0.17
207 0.19
208 0.18
209 0.18
210 0.18
211 0.15
212 0.13
213 0.11
214 0.09
215 0.08
216 0.08
217 0.08
218 0.07
219 0.07
220 0.1
221 0.11
222 0.11
223 0.1
224 0.1
225 0.13
226 0.14
227 0.21
228 0.2
229 0.23
230 0.24
231 0.25
232 0.24
233 0.21
234 0.2
235 0.14
236 0.13
237 0.1
238 0.09
239 0.08
240 0.08
241 0.09
242 0.08
243 0.1
244 0.09
245 0.08
246 0.08
247 0.09
248 0.11
249 0.11
250 0.13
251 0.11
252 0.12
253 0.12
254 0.12
255 0.12
256 0.11
257 0.11
258 0.11
259 0.11
260 0.11
261 0.13
262 0.23
263 0.27
264 0.31
265 0.34
266 0.35
267 0.35
268 0.44
269 0.5
270 0.42
271 0.43
272 0.42
273 0.39
274 0.42
275 0.45
276 0.36
277 0.31
278 0.29
279 0.24
280 0.22
281 0.26
282 0.23
283 0.24
284 0.23
285 0.2
286 0.2
287 0.2
288 0.19
289 0.13
290 0.1
291 0.05
292 0.05
293 0.04
294 0.03
295 0.03
296 0.03
297 0.03
298 0.03
299 0.04
300 0.05
301 0.05
302 0.05
303 0.06
304 0.06
305 0.07
306 0.08
307 0.1
308 0.12
309 0.15
310 0.23
311 0.29
312 0.38
313 0.41
314 0.47
315 0.5
316 0.58
317 0.65
318 0.65
319 0.69
320 0.68
321 0.7
322 0.73
323 0.78
324 0.8
325 0.79
326 0.81
327 0.8
328 0.76
329 0.75
330 0.7
331 0.6
332 0.59
333 0.51
334 0.46
335 0.42
336 0.39
337 0.34
338 0.29
339 0.29
340 0.19
341 0.17
342 0.12
343 0.08
344 0.08
345 0.09
346 0.08
347 0.07
348 0.07
349 0.07
350 0.08
351 0.12
352 0.12
353 0.13
354 0.16
355 0.17
356 0.22
357 0.32
358 0.36
359 0.43
360 0.46
361 0.48
362 0.49
363 0.48
364 0.44
365 0.36
366 0.3
367 0.24
368 0.21
369 0.2
370 0.16
371 0.16
372 0.15
373 0.14
374 0.14
375 0.13
376 0.13
377 0.12
378 0.15
379 0.17
380 0.2
381 0.23
382 0.29
383 0.3
384 0.3
385 0.3
386 0.31
387 0.35
388 0.33
389 0.3
390 0.27
391 0.26
392 0.26
393 0.25
394 0.24
395 0.18
396 0.19
397 0.21
398 0.19
399 0.18
400 0.18
401 0.2
402 0.19
403 0.22
404 0.24
405 0.28
406 0.34
407 0.41
408 0.51
409 0.56
410 0.65
411 0.74
412 0.78
413 0.76
414 0.79
415 0.78
416 0.76
417 0.75
418 0.71
419 0.65
420 0.6
421 0.54
422 0.46
423 0.4
424 0.31
425 0.24
426 0.19
427 0.16