Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2M1C6

Protein Details
Accession M2M1C6    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
98-126SKEDAGRVTPRQKKRQRHFPPRNYAVKAEHydrophilic
NLS Segment(s)
PositionSequence
91-117RAMRRALSKEDAGRVTPRQKKRQRHFP
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG bcom:BAUCODRAFT_29232  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSTKLKAAQLWGKNKDELKKQLDEQKQELVQLRTQKIAGGAQSKLNKIHDVRKNIARILTVINTTQRHQLRIFYAKKKYLPLDLRAKQTRAMRRALSKEDAGRVTPRQKKRQRHFPPRNYAVKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.59
4 0.59
5 0.59
6 0.56
7 0.55
8 0.56
9 0.61
10 0.63
11 0.62
12 0.56
13 0.54
14 0.49
15 0.47
16 0.47
17 0.4
18 0.37
19 0.38
20 0.37
21 0.32
22 0.31
23 0.28
24 0.24
25 0.23
26 0.22
27 0.18
28 0.17
29 0.21
30 0.24
31 0.25
32 0.26
33 0.25
34 0.26
35 0.26
36 0.34
37 0.35
38 0.38
39 0.41
40 0.44
41 0.45
42 0.42
43 0.41
44 0.32
45 0.26
46 0.22
47 0.19
48 0.14
49 0.12
50 0.15
51 0.15
52 0.16
53 0.22
54 0.21
55 0.22
56 0.22
57 0.24
58 0.24
59 0.32
60 0.38
61 0.37
62 0.43
63 0.45
64 0.46
65 0.48
66 0.46
67 0.46
68 0.44
69 0.44
70 0.48
71 0.49
72 0.55
73 0.55
74 0.54
75 0.51
76 0.54
77 0.55
78 0.49
79 0.5
80 0.46
81 0.49
82 0.54
83 0.54
84 0.51
85 0.46
86 0.45
87 0.45
88 0.42
89 0.37
90 0.35
91 0.36
92 0.41
93 0.47
94 0.53
95 0.59
96 0.67
97 0.76
98 0.82
99 0.87
100 0.89
101 0.91
102 0.93
103 0.93
104 0.94
105 0.92
106 0.91