FuNGI

M2M7T4

Protein Details

Accession

M2M7T4

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
257-278	ETYKKVILKRRAKRHNIPPPPA	Hydrophilic

NLS Segment(s)

Position	Sequence
265-270	KRRAKR

Subcellular Location(s)

plas 25

Family & Domain DBs

InterPro	View protein in InterPro IPR011701 MFS IPR020846 MFS_dom IPR036259 MFS_trans_sf
Gene Ontology	GO:0016020 C:membrane GO:0022857 F:transmembrane transporter activity
KEGG	bcom:BAUCODRAFT_78054 -
Pfam	View protein in Pfam PF07690 MFS_1
PROSITE	View protein in PROSITE PS50850 MFS
CDD	cd17323 MFS_Tpo1_MDR_like

Amino Acid Sequences

MQSQEAVRSESDSILEAIEVGSADDDHDSELPDLHDLEKAATSTTQHTKGEPAARTLTAQDWTGPDDPENPHNWQLWRRNFTLFGIASLAFTVTAGSSMITPATFEIAAYYGVSRTASILSLSLFVLGLGLGPMLAAPLSETYGRSIVYKLSGPLYMLFILGAGFSKNFGGMLVCRLLAGIVGGPVLAVGGGTVADMYTQKNRALGSAMFIMSPFLGPALGPVIGGFAAQYKGWKWTQWCTIFIALAAYAFVLPMPETYKKVILKRRAKRHNIPPPPAPAMTTAGYIKLLITITLARPLVMLFTEPIVLFFSLYNAFTFSVLFSFFAAYPYTFERVYGFNTWQYGLTFLGIGVGVILAVVTLILVDRLVYTPLHLQGVKEGKQNIAPEHRLYAAMAGAFGIPVGLFWFAWTARRSVHWISPVIAGMPFAWGNAAVFISVATYLVDVYGPLNGASALAANGLARYTMGAVFPLFTVQMYSTLGIGWATSLLAFVSVAMLPIPFVFFRFGPKIRDMSKYSMTAQQKK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.13
2	0.13
3	0.1
4	0.08
5	0.08
6	0.07
7	0.06
8	0.06
9	0.05
10	0.06
11	0.07
12	0.07
13	0.08
14	0.09
15	0.1
16	0.1
17	0.12
18	0.12
19	0.13
20	0.14
21	0.13
22	0.14
23	0.13
24	0.14
25	0.14
26	0.14
27	0.14
28	0.14
29	0.15
30	0.2
31	0.26
32	0.3
33	0.29
34	0.3
35	0.32
36	0.38
37	0.44
38	0.39
39	0.37
40	0.35
41	0.35
42	0.35
43	0.34
44	0.3
45	0.24
46	0.23
47	0.2
48	0.18
49	0.21
50	0.22
51	0.21
52	0.19
53	0.22
54	0.25
55	0.28
56	0.31
57	0.3
58	0.32
59	0.36
60	0.39
61	0.43
62	0.5
63	0.54
64	0.56
65	0.54
66	0.54
67	0.51
68	0.49
69	0.48
70	0.38
71	0.29
72	0.26
73	0.24
74	0.2
75	0.18
76	0.17
77	0.08
78	0.08
79	0.07
80	0.04
81	0.05
82	0.05
83	0.05
84	0.05
85	0.05
86	0.06
87	0.05
88	0.06
89	0.06
90	0.07
91	0.07
92	0.06
93	0.07
94	0.07
95	0.08
96	0.08
97	0.08
98	0.07
99	0.07
100	0.08
101	0.07
102	0.07
103	0.08
104	0.08
105	0.08
106	0.08
107	0.08
108	0.09
109	0.09
110	0.08
111	0.07
112	0.06
113	0.06
114	0.05
115	0.05
116	0.03
117	0.03
118	0.02
119	0.02
120	0.02
121	0.02
122	0.02
123	0.02
124	0.03
125	0.03
126	0.05
127	0.06
128	0.07
129	0.08
130	0.1
131	0.1
132	0.11
133	0.11
134	0.11
135	0.12
136	0.13
137	0.13
138	0.13
139	0.13
140	0.13
141	0.13
142	0.14
143	0.12
144	0.11
145	0.09
146	0.08
147	0.07
148	0.06
149	0.06
150	0.04
151	0.04
152	0.05
153	0.05
154	0.05
155	0.05
156	0.05
157	0.06
158	0.06
159	0.08
160	0.08
161	0.08
162	0.08
163	0.08
164	0.08
165	0.07
166	0.06
167	0.04
168	0.03
169	0.03
170	0.03
171	0.03
172	0.03
173	0.03
174	0.02
175	0.02
176	0.02
177	0.02
178	0.02
179	0.02
180	0.02
181	0.02
182	0.03
183	0.03
184	0.05
185	0.08
186	0.11
187	0.11
188	0.13
189	0.13
190	0.13
191	0.16
192	0.14
193	0.13
194	0.14
195	0.13
196	0.11
197	0.11
198	0.11
199	0.08
200	0.08
201	0.06
202	0.03
203	0.03
204	0.03
205	0.03
206	0.04
207	0.04
208	0.04
209	0.04
210	0.04
211	0.04
212	0.04
213	0.04
214	0.04
215	0.04
216	0.05
217	0.06
218	0.06
219	0.1
220	0.11
221	0.13
222	0.15
223	0.19
224	0.27
225	0.29
226	0.3
227	0.28
228	0.28
229	0.26
230	0.23
231	0.19
232	0.1
233	0.08
234	0.06
235	0.04
236	0.03
237	0.03
238	0.03
239	0.02
240	0.03
241	0.03
242	0.06
243	0.08
244	0.09
245	0.11
246	0.15
247	0.19
248	0.25
249	0.32
250	0.39
251	0.48
252	0.56
253	0.65
254	0.71
255	0.76
256	0.79
257	0.82
258	0.83
259	0.82
260	0.78
261	0.71
262	0.66
263	0.61
264	0.52
265	0.42
266	0.33
267	0.27
268	0.22
269	0.2
270	0.15
271	0.12
272	0.12
273	0.11
274	0.09
275	0.07
276	0.06
277	0.05
278	0.06
279	0.06
280	0.06
281	0.1
282	0.1
283	0.08
284	0.08
285	0.08
286	0.08
287	0.07
288	0.07
289	0.04
290	0.05
291	0.06
292	0.06
293	0.06
294	0.07
295	0.07
296	0.07
297	0.06
298	0.07
299	0.07
300	0.08
301	0.08
302	0.08
303	0.08
304	0.08
305	0.08
306	0.07
307	0.06
308	0.06
309	0.07
310	0.06
311	0.07
312	0.07
313	0.08
314	0.08
315	0.08
316	0.09
317	0.11
318	0.13
319	0.11
320	0.11
321	0.12
322	0.12
323	0.16
324	0.17
325	0.16
326	0.16
327	0.17
328	0.17
329	0.16
330	0.15
331	0.13
332	0.11
333	0.09
334	0.08
335	0.07
336	0.07
337	0.06
338	0.05
339	0.04
340	0.03
341	0.03
342	0.02
343	0.02
344	0.02
345	0.02
346	0.02
347	0.01
348	0.01
349	0.02
350	0.02
351	0.02
352	0.02
353	0.03
354	0.04
355	0.05
356	0.05
357	0.07
358	0.09
359	0.11
360	0.14
361	0.14
362	0.13
363	0.19
364	0.25
365	0.26
366	0.28
367	0.28
368	0.27
369	0.3
370	0.32
371	0.31
372	0.32
373	0.32
374	0.29
375	0.3
376	0.3
377	0.26
378	0.24
379	0.2
380	0.14
381	0.11
382	0.09
383	0.07
384	0.06
385	0.06
386	0.05
387	0.04
388	0.03
389	0.03
390	0.04
391	0.04
392	0.04
393	0.04
394	0.07
395	0.07
396	0.12
397	0.13
398	0.13
399	0.14
400	0.17
401	0.22
402	0.24
403	0.29
404	0.29
405	0.3
406	0.31
407	0.31
408	0.3
409	0.25
410	0.21
411	0.16
412	0.12
413	0.12
414	0.1
415	0.08
416	0.08
417	0.07
418	0.07
419	0.07
420	0.07
421	0.05
422	0.05
423	0.05
424	0.05
425	0.05
426	0.05
427	0.04
428	0.04
429	0.04
430	0.05
431	0.05
432	0.04
433	0.05
434	0.05
435	0.06
436	0.06
437	0.06
438	0.06
439	0.06
440	0.06
441	0.06
442	0.05
443	0.05
444	0.05
445	0.05
446	0.05
447	0.05
448	0.05
449	0.05
450	0.05
451	0.06
452	0.07
453	0.07
454	0.08
455	0.08
456	0.09
457	0.09
458	0.09
459	0.08
460	0.07
461	0.09
462	0.08
463	0.1
464	0.11
465	0.11
466	0.1
467	0.1
468	0.1
469	0.09
470	0.08
471	0.06
472	0.05
473	0.05
474	0.05
475	0.05
476	0.04
477	0.05
478	0.05
479	0.04
480	0.06
481	0.06
482	0.06
483	0.06
484	0.06
485	0.06
486	0.06
487	0.09
488	0.07
489	0.09
490	0.11
491	0.12
492	0.19
493	0.26
494	0.3
495	0.33
496	0.38
497	0.44
498	0.44
499	0.52
500	0.5
501	0.49
502	0.52
503	0.5
504	0.49
505	0.51

M2M7T4

3D AlphaFold-predicted Structure Viewer