Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2N0Y3

Protein Details
Accession M2N0Y3    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
27-53LQHRRQRQSRLLSRQRHRYPRRTLPRSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 11, cyto 1, plas 1, extr 1
Family & Domain DBs
KEGG bcom:BAUCODRAFT_254058  -  
Amino Acid Sequences MRCMPILTRLRLALLLEPLPHRYVHLLQHRRQRQSRLLSRQRHRYPRRTLPRSDCWHPYSCCSGLPAARTGCHTSVVALRTPRKTSSAAAAGNIISPLGDGRRRTSDSRSRRPPEAARPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.19
4 0.2
5 0.21
6 0.21
7 0.2
8 0.18
9 0.18
10 0.2
11 0.26
12 0.35
13 0.41
14 0.46
15 0.57
16 0.63
17 0.68
18 0.71
19 0.69
20 0.67
21 0.7
22 0.73
23 0.74
24 0.76
25 0.77
26 0.79
27 0.83
28 0.84
29 0.84
30 0.83
31 0.81
32 0.81
33 0.82
34 0.85
35 0.8
36 0.78
37 0.75
38 0.76
39 0.73
40 0.68
41 0.63
42 0.56
43 0.55
44 0.49
45 0.43
46 0.38
47 0.32
48 0.28
49 0.23
50 0.2
51 0.16
52 0.17
53 0.18
54 0.14
55 0.14
56 0.16
57 0.18
58 0.17
59 0.17
60 0.16
61 0.13
62 0.16
63 0.17
64 0.18
65 0.2
66 0.24
67 0.26
68 0.29
69 0.29
70 0.29
71 0.3
72 0.28
73 0.29
74 0.31
75 0.28
76 0.26
77 0.25
78 0.22
79 0.21
80 0.19
81 0.13
82 0.06
83 0.06
84 0.06
85 0.09
86 0.13
87 0.14
88 0.19
89 0.26
90 0.3
91 0.34
92 0.42
93 0.48
94 0.55
95 0.64
96 0.71
97 0.7
98 0.72
99 0.76
100 0.76