Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S516

Protein Details
Accession F4S516   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MTNQKKVKLKKPENLKRKPQNKLDARCLAHydrophilic
NLS Segment(s)
PositionSequence
5-20KKVKLKKPENLKRKPQ
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 3
Family & Domain DBs
KEGG mlr:MELLADRAFT_93724  -  
Amino Acid Sequences MTNQKKVKLKKPENLKRKPQNKLDARCLAMKRRSRVHAEITVGQAVSNAAEQYDCADPLVPGGSGDIIIPMAELPAFDEGDRDEEPDQLGQLPPSPPPHDANLTGEVFAFGLNEGFHAGRRQREEEDWRNRYPAMFPVFLACQQRTNNWSNVETRFKDWKEPCNCTGTIRTFDVLDLTYKVEDVSMFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.89
4 0.89
5 0.9
6 0.88
7 0.88
8 0.87
9 0.85
10 0.84
11 0.8
12 0.74
13 0.71
14 0.66
15 0.65
16 0.63
17 0.62
18 0.59
19 0.6
20 0.63
21 0.63
22 0.63
23 0.61
24 0.58
25 0.55
26 0.52
27 0.46
28 0.42
29 0.34
30 0.29
31 0.22
32 0.16
33 0.12
34 0.09
35 0.06
36 0.05
37 0.05
38 0.05
39 0.07
40 0.08
41 0.08
42 0.07
43 0.08
44 0.07
45 0.08
46 0.09
47 0.06
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.04
54 0.04
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.09
68 0.09
69 0.1
70 0.09
71 0.09
72 0.1
73 0.1
74 0.1
75 0.08
76 0.08
77 0.06
78 0.08
79 0.08
80 0.09
81 0.12
82 0.13
83 0.15
84 0.16
85 0.18
86 0.19
87 0.19
88 0.2
89 0.21
90 0.2
91 0.18
92 0.16
93 0.14
94 0.11
95 0.1
96 0.07
97 0.04
98 0.04
99 0.03
100 0.04
101 0.05
102 0.05
103 0.06
104 0.09
105 0.12
106 0.16
107 0.2
108 0.22
109 0.24
110 0.3
111 0.38
112 0.45
113 0.53
114 0.54
115 0.52
116 0.51
117 0.48
118 0.44
119 0.36
120 0.33
121 0.27
122 0.22
123 0.21
124 0.22
125 0.23
126 0.25
127 0.28
128 0.22
129 0.22
130 0.23
131 0.27
132 0.3
133 0.33
134 0.34
135 0.34
136 0.35
137 0.34
138 0.39
139 0.44
140 0.41
141 0.42
142 0.46
143 0.44
144 0.51
145 0.52
146 0.56
147 0.56
148 0.6
149 0.58
150 0.55
151 0.54
152 0.48
153 0.51
154 0.46
155 0.42
156 0.38
157 0.36
158 0.31
159 0.31
160 0.28
161 0.22
162 0.18
163 0.15
164 0.15
165 0.14
166 0.13
167 0.13
168 0.12