Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2MVG7

Protein Details
Accession M2MVG7    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
44-64VSQRSRYRWIARPPRRASLRHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.5, nucl 13, mito 12
Family & Domain DBs
KEGG bcom:BAUCODRAFT_34295  -  
Amino Acid Sequences MRGSNVVKPRLYRVCANDRLTHRMPPFIRNLLWPNRPLPCTLHVSQRSRYRWIARPPRRASLRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.57
3 0.59
4 0.58
5 0.54
6 0.58
7 0.54
8 0.54
9 0.45
10 0.45
11 0.42
12 0.39
13 0.39
14 0.34
15 0.33
16 0.29
17 0.34
18 0.33
19 0.34
20 0.32
21 0.3
22 0.31
23 0.31
24 0.29
25 0.26
26 0.23
27 0.27
28 0.27
29 0.34
30 0.38
31 0.42
32 0.48
33 0.54
34 0.54
35 0.53
36 0.58
37 0.55
38 0.57
39 0.63
40 0.68
41 0.69
42 0.76
43 0.77
44 0.8