Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2NFS4

Protein Details
Accession M2NFS4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
54-73VRKYPAYGIRRPPRRKIGPDBasic
NLS Segment(s)
PositionSequence
62-70IRRPPRRKI
Subcellular Location(s) mito 23, cyto 1, plas 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
KEGG bcom:BAUCODRAFT_405811  -  
Amino Acid Sequences MIGKVTAEYAVPFAGWCSGRLRSGSFGRPMTARRVDHARFVLTHVPGLTSARGVRKYPAYGIRRPPRRKIGPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.14
5 0.16
6 0.18
7 0.19
8 0.2
9 0.21
10 0.25
11 0.28
12 0.29
13 0.28
14 0.28
15 0.28
16 0.28
17 0.3
18 0.32
19 0.28
20 0.26
21 0.32
22 0.32
23 0.34
24 0.33
25 0.28
26 0.22
27 0.24
28 0.26
29 0.19
30 0.19
31 0.15
32 0.14
33 0.13
34 0.14
35 0.12
36 0.09
37 0.11
38 0.15
39 0.18
40 0.19
41 0.22
42 0.25
43 0.27
44 0.31
45 0.38
46 0.39
47 0.44
48 0.54
49 0.61
50 0.67
51 0.72
52 0.76
53 0.77