Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RNH2

Protein Details
Accession F4RNH2   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
119-142EERHAWENRRQRREKQHCCKPPGSBasic
256-276TAYWKRKTIPKERRSAKQQEVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
KEGG mlr:MELLADRAFT_107045  -  
Amino Acid Sequences MSSQPTCTLKTPNAGGTGKKCCLEEEDHSDGDGDLTHEEVLEQKQNITAKLKALTQIRHRNEGIGKVAGHHPVPKAATPFARAIHEFVKILMGIQRKSRGSSALEDASLKKMPDPPTEEERHAWENRRQRREKQHCCKPPGSTSPLVWQQGPKISRTKSKVAMKSTPEGQKTLEDNVAIAKSITSKQRNMTKIYEARVYMAAKFFVKDSPEAAMLSHPKVQSKDELVSSNSCGSRQKLRLEWRSKELDTLIGLLDTAYWKRKTIPKERRSAKQQEVIVLSELELDENNKVDIWSAIEDSKITFKSLSVLAAEQNGASGSNGMNTQQQNGPSGYNYVMNTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.45
4 0.49
5 0.46
6 0.45
7 0.42
8 0.36
9 0.38
10 0.39
11 0.38
12 0.39
13 0.4
14 0.38
15 0.38
16 0.37
17 0.32
18 0.26
19 0.2
20 0.13
21 0.08
22 0.08
23 0.08
24 0.07
25 0.07
26 0.1
27 0.12
28 0.16
29 0.17
30 0.16
31 0.21
32 0.23
33 0.26
34 0.28
35 0.27
36 0.25
37 0.27
38 0.29
39 0.3
40 0.34
41 0.38
42 0.44
43 0.53
44 0.53
45 0.57
46 0.56
47 0.55
48 0.53
49 0.5
50 0.44
51 0.37
52 0.32
53 0.28
54 0.31
55 0.28
56 0.26
57 0.25
58 0.22
59 0.22
60 0.24
61 0.24
62 0.24
63 0.25
64 0.26
65 0.26
66 0.28
67 0.26
68 0.27
69 0.25
70 0.25
71 0.24
72 0.24
73 0.21
74 0.18
75 0.17
76 0.14
77 0.13
78 0.15
79 0.17
80 0.16
81 0.2
82 0.26
83 0.26
84 0.28
85 0.28
86 0.28
87 0.26
88 0.28
89 0.29
90 0.25
91 0.24
92 0.23
93 0.23
94 0.23
95 0.22
96 0.19
97 0.16
98 0.2
99 0.24
100 0.28
101 0.32
102 0.34
103 0.4
104 0.43
105 0.44
106 0.39
107 0.39
108 0.39
109 0.37
110 0.37
111 0.37
112 0.43
113 0.5
114 0.59
115 0.6
116 0.64
117 0.72
118 0.78
119 0.82
120 0.83
121 0.85
122 0.83
123 0.85
124 0.8
125 0.72
126 0.68
127 0.63
128 0.58
129 0.5
130 0.42
131 0.41
132 0.42
133 0.39
134 0.33
135 0.27
136 0.23
137 0.27
138 0.26
139 0.23
140 0.24
141 0.26
142 0.32
143 0.36
144 0.39
145 0.41
146 0.48
147 0.52
148 0.51
149 0.55
150 0.5
151 0.49
152 0.5
153 0.47
154 0.4
155 0.35
156 0.3
157 0.27
158 0.26
159 0.25
160 0.2
161 0.14
162 0.13
163 0.13
164 0.12
165 0.09
166 0.07
167 0.05
168 0.06
169 0.09
170 0.16
171 0.18
172 0.21
173 0.26
174 0.34
175 0.37
176 0.4
177 0.4
178 0.41
179 0.41
180 0.41
181 0.39
182 0.32
183 0.3
184 0.29
185 0.27
186 0.2
187 0.17
188 0.16
189 0.13
190 0.13
191 0.12
192 0.11
193 0.12
194 0.11
195 0.11
196 0.12
197 0.13
198 0.12
199 0.12
200 0.13
201 0.14
202 0.15
203 0.18
204 0.17
205 0.19
206 0.21
207 0.22
208 0.23
209 0.24
210 0.24
211 0.23
212 0.24
213 0.24
214 0.24
215 0.24
216 0.24
217 0.21
218 0.2
219 0.2
220 0.21
221 0.27
222 0.31
223 0.34
224 0.38
225 0.47
226 0.56
227 0.62
228 0.63
229 0.61
230 0.62
231 0.57
232 0.52
233 0.43
234 0.35
235 0.27
236 0.24
237 0.18
238 0.11
239 0.11
240 0.08
241 0.08
242 0.07
243 0.09
244 0.14
245 0.14
246 0.15
247 0.21
248 0.27
249 0.36
250 0.45
251 0.55
252 0.58
253 0.68
254 0.74
255 0.78
256 0.81
257 0.82
258 0.79
259 0.75
260 0.68
261 0.63
262 0.59
263 0.51
264 0.43
265 0.33
266 0.25
267 0.19
268 0.17
269 0.11
270 0.09
271 0.09
272 0.08
273 0.09
274 0.09
275 0.08
276 0.08
277 0.09
278 0.09
279 0.1
280 0.11
281 0.12
282 0.13
283 0.13
284 0.13
285 0.14
286 0.19
287 0.17
288 0.16
289 0.15
290 0.14
291 0.18
292 0.18
293 0.19
294 0.15
295 0.16
296 0.16
297 0.17
298 0.17
299 0.13
300 0.13
301 0.11
302 0.1
303 0.09
304 0.09
305 0.07
306 0.09
307 0.1
308 0.1
309 0.17
310 0.17
311 0.21
312 0.23
313 0.25
314 0.26
315 0.27
316 0.28
317 0.23
318 0.25
319 0.22
320 0.23