Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2M7A1

Protein Details
Accession M2M7A1    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGQKHNRKRTRHRSMSSRRRHSLLBasic
NLS Segment(s)
PositionSequence
7-19RKRTRHRSMSSRR
Subcellular Location(s) mito 14.5, mito_nucl 12.833, nucl 10, cyto_nucl 6.833
Family & Domain DBs
KEGG bcom:BAUCODRAFT_281232  -  
Amino Acid Sequences MGQKHNRKRTRHRSMSSRRRHSLLPSCGALSPSGGICGLPSSLPFSNIARTDSAQSSSDGVSDRQSSERCPQPDNEAELAYNREQRIFGGVYGEPDASSLCGPMLDVVLGLFNGVDYEDPIVSGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.92
4 0.91
5 0.84
6 0.77
7 0.71
8 0.69
9 0.68
10 0.64
11 0.57
12 0.49
13 0.45
14 0.43
15 0.4
16 0.31
17 0.22
18 0.16
19 0.11
20 0.09
21 0.08
22 0.07
23 0.06
24 0.07
25 0.06
26 0.05
27 0.06
28 0.09
29 0.1
30 0.11
31 0.12
32 0.12
33 0.16
34 0.17
35 0.18
36 0.15
37 0.15
38 0.17
39 0.17
40 0.18
41 0.15
42 0.14
43 0.14
44 0.13
45 0.13
46 0.11
47 0.1
48 0.1
49 0.1
50 0.1
51 0.12
52 0.12
53 0.14
54 0.19
55 0.25
56 0.25
57 0.26
58 0.26
59 0.3
60 0.33
61 0.35
62 0.31
63 0.25
64 0.23
65 0.22
66 0.24
67 0.2
68 0.2
69 0.16
70 0.15
71 0.15
72 0.15
73 0.18
74 0.16
75 0.14
76 0.13
77 0.13
78 0.14
79 0.15
80 0.15
81 0.11
82 0.1
83 0.1
84 0.08
85 0.08
86 0.07
87 0.05
88 0.05
89 0.06
90 0.06
91 0.06
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.04
99 0.03
100 0.04
101 0.04
102 0.04
103 0.05
104 0.07
105 0.07