Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RI40

Protein Details
Accession F4RI40   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-95NYVYHKSKDRFKNAKERWKRIAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, mito 4
Family & Domain DBs
KEGG mlr:MELLADRAFT_105431  -  
Amino Acid Sequences MEFFTHDSELKRETEVVEGMGFLHELITFKLESAYKSLRAHQNLQAERNTSGAGSESSESDSESDDEPAGSDQNYVYHKSKDRFKNAKERWKRIALTTIQMISYGCQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.17
4 0.14
5 0.13
6 0.11
7 0.11
8 0.09
9 0.06
10 0.06
11 0.05
12 0.06
13 0.06
14 0.07
15 0.07
16 0.07
17 0.1
18 0.1
19 0.11
20 0.15
21 0.17
22 0.2
23 0.22
24 0.27
25 0.32
26 0.35
27 0.38
28 0.38
29 0.45
30 0.43
31 0.44
32 0.41
33 0.35
34 0.32
35 0.29
36 0.23
37 0.14
38 0.12
39 0.09
40 0.08
41 0.07
42 0.07
43 0.06
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.08
50 0.08
51 0.08
52 0.07
53 0.07
54 0.08
55 0.08
56 0.07
57 0.06
58 0.06
59 0.06
60 0.09
61 0.11
62 0.16
63 0.18
64 0.22
65 0.29
66 0.33
67 0.43
68 0.48
69 0.57
70 0.62
71 0.66
72 0.73
73 0.76
74 0.82
75 0.84
76 0.83
77 0.8
78 0.79
79 0.74
80 0.67
81 0.67
82 0.59
83 0.54
84 0.51
85 0.44
86 0.36
87 0.34
88 0.3