Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2MWE1

Protein Details
Accession M2MWE1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
40-63TYYDVKKDKKGNKVIERHRTQRGSHydrophilic
NLS Segment(s)
PositionSequence
196-205TKAEKKTAKK
Subcellular Location(s) mito 14.5, cyto_mito 11.833, cyto 8, cyto_nucl 4.833
Family & Domain DBs
KEGG bcom:BAUCODRAFT_144848  -  
Amino Acid Sequences MPPLACLRYLSGANPFRLVAVDADTGKPIDPNIGRKTYVTYYDVKKDKKGNKVIERHRTQRGSQVGEGQGKDEQKKCCKCDGGGEKKPEGRVGKKEGNGDGGDSNEKTGSGGDDDKPFTPDEDAKIKAMKAEGRTWNQIATELGNGRTKGAVSGRCKELSKTEGQGLGRKPNASGERSNEKDNTKPAAAANKPAMTKAEKKTAKKAAAAEAATAATANAPPPASKPASTHGSAPGSEVRYTLSEWQTLQEDSTFSFGELQCLSEIINQDLTLTWGRVAARFYDLTGRRIHPDEIREKFEAMVVGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.26
4 0.26
5 0.25
6 0.17
7 0.15
8 0.17
9 0.17
10 0.17
11 0.18
12 0.18
13 0.17
14 0.16
15 0.13
16 0.17
17 0.2
18 0.27
19 0.32
20 0.36
21 0.36
22 0.37
23 0.42
24 0.38
25 0.39
26 0.34
27 0.34
28 0.36
29 0.44
30 0.51
31 0.48
32 0.51
33 0.56
34 0.61
35 0.65
36 0.69
37 0.7
38 0.72
39 0.79
40 0.83
41 0.84
42 0.84
43 0.81
44 0.81
45 0.75
46 0.67
47 0.65
48 0.62
49 0.57
50 0.5
51 0.5
52 0.46
53 0.46
54 0.44
55 0.37
56 0.34
57 0.32
58 0.36
59 0.34
60 0.37
61 0.42
62 0.49
63 0.51
64 0.55
65 0.55
66 0.5
67 0.55
68 0.58
69 0.59
70 0.6
71 0.61
72 0.59
73 0.58
74 0.58
75 0.54
76 0.49
77 0.44
78 0.43
79 0.45
80 0.48
81 0.48
82 0.51
83 0.46
84 0.44
85 0.38
86 0.33
87 0.25
88 0.2
89 0.19
90 0.15
91 0.14
92 0.11
93 0.1
94 0.09
95 0.08
96 0.08
97 0.08
98 0.1
99 0.11
100 0.14
101 0.16
102 0.16
103 0.17
104 0.17
105 0.15
106 0.15
107 0.15
108 0.16
109 0.18
110 0.19
111 0.19
112 0.2
113 0.19
114 0.18
115 0.18
116 0.18
117 0.17
118 0.22
119 0.27
120 0.29
121 0.32
122 0.32
123 0.31
124 0.27
125 0.25
126 0.19
127 0.13
128 0.12
129 0.1
130 0.11
131 0.13
132 0.13
133 0.12
134 0.12
135 0.11
136 0.11
137 0.13
138 0.17
139 0.19
140 0.23
141 0.25
142 0.27
143 0.28
144 0.27
145 0.27
146 0.24
147 0.23
148 0.21
149 0.2
150 0.22
151 0.22
152 0.26
153 0.25
154 0.28
155 0.26
156 0.25
157 0.23
158 0.25
159 0.28
160 0.26
161 0.27
162 0.27
163 0.34
164 0.36
165 0.38
166 0.36
167 0.35
168 0.35
169 0.35
170 0.34
171 0.26
172 0.25
173 0.24
174 0.28
175 0.27
176 0.28
177 0.28
178 0.27
179 0.27
180 0.26
181 0.27
182 0.23
183 0.29
184 0.29
185 0.36
186 0.39
187 0.42
188 0.51
189 0.57
190 0.56
191 0.53
192 0.52
193 0.47
194 0.46
195 0.43
196 0.35
197 0.27
198 0.23
199 0.19
200 0.16
201 0.1
202 0.05
203 0.05
204 0.05
205 0.06
206 0.06
207 0.06
208 0.09
209 0.14
210 0.16
211 0.17
212 0.19
213 0.23
214 0.28
215 0.28
216 0.28
217 0.28
218 0.28
219 0.27
220 0.27
221 0.26
222 0.24
223 0.23
224 0.22
225 0.18
226 0.17
227 0.19
228 0.23
229 0.2
230 0.19
231 0.2
232 0.22
233 0.22
234 0.21
235 0.21
236 0.15
237 0.14
238 0.13
239 0.15
240 0.13
241 0.11
242 0.16
243 0.15
244 0.17
245 0.17
246 0.17
247 0.14
248 0.14
249 0.15
250 0.13
251 0.14
252 0.13
253 0.14
254 0.13
255 0.13
256 0.13
257 0.15
258 0.14
259 0.13
260 0.11
261 0.13
262 0.14
263 0.16
264 0.17
265 0.16
266 0.18
267 0.18
268 0.19
269 0.26
270 0.28
271 0.29
272 0.33
273 0.34
274 0.35
275 0.38
276 0.41
277 0.37
278 0.43
279 0.5
280 0.5
281 0.54
282 0.51
283 0.48
284 0.44
285 0.41