Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2N2Q6

Protein Details
Accession M2N2Q6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
119-168PKENGEKAPPKKKGRPAKKEANGDKAPKAKAEPKKKREPKKAATESGEPRBasic
NLS Segment(s)
PositionSequence
109-176RKADDKEAEEPKENGEKAPPKKKGRPAKKEANGDKAPKAKAEPKKKREPKKAATESGEPRRSGRHASK
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
KEGG bcom:BAUCODRAFT_37852  -  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MPEEIKEGDQVSWQWSGGRPGGEAAEVKEQGEMKITTKKGNEVKKNADPENPAVKIKRSGQDVVKKASELDVEESSGKKDGGDGKTDEKDEPNGEKEDEEKEAQAGDKRKADDKEAEEPKENGEKAPPKKKGRPAKKEANGDKAPKAKAEPKKKREPKKAATESGEPRRSGRHASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.22
4 0.22
5 0.21
6 0.19
7 0.19
8 0.19
9 0.19
10 0.17
11 0.16
12 0.19
13 0.19
14 0.18
15 0.19
16 0.19
17 0.18
18 0.21
19 0.19
20 0.16
21 0.23
22 0.24
23 0.27
24 0.28
25 0.36
26 0.39
27 0.48
28 0.54
29 0.54
30 0.6
31 0.62
32 0.67
33 0.62
34 0.59
35 0.53
36 0.49
37 0.49
38 0.43
39 0.39
40 0.34
41 0.34
42 0.34
43 0.36
44 0.35
45 0.32
46 0.34
47 0.39
48 0.46
49 0.47
50 0.46
51 0.42
52 0.37
53 0.33
54 0.31
55 0.24
56 0.17
57 0.16
58 0.12
59 0.12
60 0.13
61 0.13
62 0.12
63 0.13
64 0.11
65 0.08
66 0.09
67 0.14
68 0.15
69 0.18
70 0.19
71 0.21
72 0.23
73 0.25
74 0.23
75 0.18
76 0.18
77 0.17
78 0.17
79 0.16
80 0.16
81 0.15
82 0.15
83 0.15
84 0.15
85 0.16
86 0.14
87 0.12
88 0.11
89 0.11
90 0.12
91 0.15
92 0.17
93 0.18
94 0.21
95 0.22
96 0.28
97 0.29
98 0.31
99 0.33
100 0.34
101 0.4
102 0.43
103 0.44
104 0.41
105 0.4
106 0.39
107 0.39
108 0.34
109 0.25
110 0.27
111 0.32
112 0.38
113 0.48
114 0.54
115 0.57
116 0.65
117 0.75
118 0.79
119 0.81
120 0.83
121 0.83
122 0.85
123 0.85
124 0.87
125 0.84
126 0.82
127 0.78
128 0.71
129 0.69
130 0.64
131 0.56
132 0.48
133 0.48
134 0.47
135 0.51
136 0.58
137 0.62
138 0.66
139 0.76
140 0.84
141 0.89
142 0.91
143 0.91
144 0.9
145 0.9
146 0.9
147 0.87
148 0.83
149 0.8
150 0.79
151 0.79
152 0.74
153 0.64
154 0.56
155 0.54
156 0.52