Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2MQT8

Protein Details
Accession M2MQT8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
57-77RGRGSPFKRRCRFKSHFVRGLBasic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12.5, cyto 3.5
Family & Domain DBs
KEGG bcom:BAUCODRAFT_212495  -  
Amino Acid Sequences MVTVRTQVQAFTRPMDYRVFRGTSLDEHLIVARPAQDNRLGHYITRLTLRSSFAFYRGRGSPFKRRCRFKSHFVRGLHSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.33
4 0.3
5 0.33
6 0.32
7 0.27
8 0.28
9 0.28
10 0.23
11 0.25
12 0.23
13 0.18
14 0.17
15 0.17
16 0.16
17 0.14
18 0.12
19 0.1
20 0.1
21 0.11
22 0.12
23 0.16
24 0.15
25 0.18
26 0.21
27 0.19
28 0.17
29 0.19
30 0.18
31 0.15
32 0.17
33 0.15
34 0.14
35 0.15
36 0.18
37 0.17
38 0.2
39 0.19
40 0.21
41 0.24
42 0.23
43 0.26
44 0.26
45 0.29
46 0.32
47 0.38
48 0.44
49 0.51
50 0.61
51 0.66
52 0.72
53 0.75
54 0.79
55 0.79
56 0.79
57 0.81
58 0.8
59 0.79
60 0.73