Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2M8S2

Protein Details
Accession M2M8S2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-44MAPLTRKRKRVRGVQEPRQLAPESIAARRKKPKHAELSHRQARDHydrophilic
NLS Segment(s)
PositionSequence
6-35RKRKRVRGVQEPRQLAPESIAARRKKPKHA
Subcellular Location(s) nucl 12, mito 11, cyto_nucl 9, cyto 4
Family & Domain DBs
KEGG bcom:BAUCODRAFT_568984  -  
Amino Acid Sequences MAPLTRKRKRVRGVQEPRQLAPESIAARRKKPKHAELSHRQARDCSKGGPGRAPQAPPQVRNQIYELVLAPDICGLSRCSLGTSKWYTKDRLSTLVQGPGPGRQVFNSALHKDFEDAATVVGHSSSTAFRNCTTLPSYRSRSQVCFGLPNGSAWKHYPSSSKLLASSSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.82
4 0.74
5 0.68
6 0.59
7 0.48
8 0.39
9 0.34
10 0.27
11 0.29
12 0.36
13 0.34
14 0.41
15 0.5
16 0.55
17 0.59
18 0.66
19 0.7
20 0.73
21 0.79
22 0.82
23 0.82
24 0.87
25 0.84
26 0.77
27 0.68
28 0.61
29 0.56
30 0.52
31 0.44
32 0.35
33 0.35
34 0.37
35 0.38
36 0.4
37 0.38
38 0.37
39 0.38
40 0.39
41 0.35
42 0.41
43 0.43
44 0.39
45 0.42
46 0.45
47 0.43
48 0.43
49 0.4
50 0.33
51 0.29
52 0.28
53 0.23
54 0.15
55 0.14
56 0.12
57 0.1
58 0.07
59 0.06
60 0.05
61 0.06
62 0.05
63 0.06
64 0.07
65 0.07
66 0.08
67 0.09
68 0.1
69 0.14
70 0.18
71 0.2
72 0.25
73 0.28
74 0.29
75 0.3
76 0.34
77 0.31
78 0.31
79 0.3
80 0.29
81 0.28
82 0.3
83 0.28
84 0.24
85 0.23
86 0.2
87 0.21
88 0.17
89 0.16
90 0.12
91 0.15
92 0.15
93 0.19
94 0.23
95 0.23
96 0.23
97 0.24
98 0.24
99 0.22
100 0.2
101 0.16
102 0.12
103 0.1
104 0.09
105 0.09
106 0.08
107 0.07
108 0.07
109 0.06
110 0.04
111 0.05
112 0.07
113 0.09
114 0.11
115 0.13
116 0.13
117 0.17
118 0.17
119 0.2
120 0.21
121 0.24
122 0.27
123 0.33
124 0.4
125 0.41
126 0.48
127 0.48
128 0.49
129 0.47
130 0.48
131 0.43
132 0.4
133 0.36
134 0.35
135 0.31
136 0.3
137 0.31
138 0.27
139 0.27
140 0.24
141 0.29
142 0.26
143 0.28
144 0.32
145 0.32
146 0.38
147 0.4
148 0.4
149 0.36