Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4SCP2

Protein Details
Accession F4SCP2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
177-197QGVVKKEKAKAKAKPKGRKKKBasic
NLS Segment(s)
PositionSequence
181-197KKEKAKAKAKPKGRKKK
Subcellular Location(s) cyto 14.5, cyto_mito 13, mito 10.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_114225  -  
Amino Acid Sequences MARKAFVATGKAGAGLKGDLPVTSLDETSKLMIAQPPIIDVEIADLLTSVPGQPHDYEAPDQPAFGGITKLLSQSELARRAFTQTNDSPIQTADGPNPSHDLIPDPPATLKVPDGGDAVGTIDPVERLILRLPNRLSAPISSNYPRPSPPTAKKVTTKANKRAVVPGKENVEPEGVQGVVKKEKAKAKAKPKGRKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.12
4 0.12
5 0.12
6 0.09
7 0.1
8 0.11
9 0.12
10 0.13
11 0.13
12 0.11
13 0.12
14 0.13
15 0.13
16 0.13
17 0.1
18 0.11
19 0.14
20 0.15
21 0.16
22 0.15
23 0.15
24 0.15
25 0.15
26 0.13
27 0.09
28 0.1
29 0.08
30 0.08
31 0.07
32 0.06
33 0.06
34 0.06
35 0.06
36 0.04
37 0.04
38 0.06
39 0.08
40 0.08
41 0.11
42 0.13
43 0.15
44 0.17
45 0.18
46 0.22
47 0.2
48 0.2
49 0.17
50 0.17
51 0.15
52 0.13
53 0.11
54 0.06
55 0.07
56 0.08
57 0.09
58 0.07
59 0.07
60 0.08
61 0.11
62 0.16
63 0.2
64 0.2
65 0.21
66 0.21
67 0.24
68 0.26
69 0.23
70 0.25
71 0.21
72 0.26
73 0.26
74 0.26
75 0.22
76 0.2
77 0.2
78 0.13
79 0.13
80 0.1
81 0.12
82 0.12
83 0.12
84 0.14
85 0.13
86 0.12
87 0.12
88 0.13
89 0.1
90 0.13
91 0.13
92 0.12
93 0.11
94 0.13
95 0.13
96 0.12
97 0.11
98 0.1
99 0.1
100 0.1
101 0.11
102 0.09
103 0.09
104 0.08
105 0.09
106 0.06
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.05
113 0.04
114 0.05
115 0.07
116 0.12
117 0.14
118 0.2
119 0.21
120 0.24
121 0.25
122 0.26
123 0.25
124 0.22
125 0.24
126 0.2
127 0.24
128 0.23
129 0.27
130 0.28
131 0.29
132 0.28
133 0.3
134 0.35
135 0.39
136 0.45
137 0.49
138 0.53
139 0.57
140 0.61
141 0.63
142 0.66
143 0.67
144 0.69
145 0.7
146 0.73
147 0.71
148 0.68
149 0.71
150 0.69
151 0.66
152 0.61
153 0.58
154 0.53
155 0.51
156 0.5
157 0.41
158 0.36
159 0.28
160 0.24
161 0.2
162 0.16
163 0.14
164 0.15
165 0.18
166 0.2
167 0.24
168 0.26
169 0.3
170 0.38
171 0.47
172 0.54
173 0.59
174 0.65
175 0.72
176 0.79
177 0.84