Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2NFE8

Protein Details
Accession M2NFE8    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-25STEYKYPKPTNRRKASEPGMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
KEGG bcom:BAUCODRAFT_33436  -  
Amino Acid Sequences MVTGLSTEYKYPKPTNRRKASEPGMGRGSDLQECAVSQRWLLTYRRLASQNRNLSHSIQAGNQLEATYKDREIANADV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.68
3 0.74
4 0.78
5 0.77
6 0.8
7 0.77
8 0.75
9 0.67
10 0.61
11 0.54
12 0.47
13 0.41
14 0.33
15 0.28
16 0.2
17 0.17
18 0.12
19 0.09
20 0.09
21 0.1
22 0.11
23 0.09
24 0.09
25 0.09
26 0.1
27 0.13
28 0.14
29 0.17
30 0.2
31 0.22
32 0.26
33 0.3
34 0.32
35 0.38
36 0.46
37 0.5
38 0.47
39 0.48
40 0.46
41 0.43
42 0.43
43 0.38
44 0.3
45 0.22
46 0.27
47 0.25
48 0.24
49 0.22
50 0.19
51 0.17
52 0.19
53 0.21
54 0.17
55 0.16
56 0.18
57 0.18
58 0.19