Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2N4B8

Protein Details
Accession M2N4B8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
195-215TDLHRERKDPNDNKKDKNPAABasic
NLS Segment(s)
Subcellular Location(s) cyto 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR002347  SDR_fam  
KEGG bcom:BAUCODRAFT_26798  -  
Pfam View protein in Pfam  
PF00106  adh_short  
Amino Acid Sequences MTFKTLDFNCALVTGGGGGIGRAISEYFLSIGKKVIICGRTESKLQEASKQMKDCPYYVLDTGNIAGIADFVTKITKEHPDLDCLVNNAGVQRPLDVNEMSAEEFTQKADNEVAINIQGPLHLIIHLLPHFKQKSGAVIMNVSSVLGYIPTSVINPVYNGTKAWVHFWSMNLRTQLEQAGANIRVIEIAPPSVGTDLHRERKDPNDNKKDKNPAALSVEEFMEDVIAQFEANEDHIGAGPSRKVLERWYGEFGPDYQKATGHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.06
4 0.06
5 0.05
6 0.05
7 0.05
8 0.04
9 0.04
10 0.05
11 0.05
12 0.05
13 0.06
14 0.07
15 0.09
16 0.11
17 0.11
18 0.12
19 0.15
20 0.15
21 0.16
22 0.21
23 0.21
24 0.22
25 0.27
26 0.31
27 0.31
28 0.33
29 0.33
30 0.32
31 0.37
32 0.37
33 0.37
34 0.39
35 0.43
36 0.48
37 0.48
38 0.47
39 0.46
40 0.47
41 0.41
42 0.37
43 0.33
44 0.29
45 0.27
46 0.25
47 0.2
48 0.18
49 0.17
50 0.14
51 0.11
52 0.08
53 0.07
54 0.05
55 0.05
56 0.05
57 0.04
58 0.04
59 0.06
60 0.06
61 0.07
62 0.09
63 0.14
64 0.16
65 0.22
66 0.23
67 0.26
68 0.28
69 0.3
70 0.28
71 0.25
72 0.22
73 0.17
74 0.16
75 0.13
76 0.12
77 0.11
78 0.1
79 0.1
80 0.1
81 0.11
82 0.13
83 0.12
84 0.11
85 0.11
86 0.11
87 0.11
88 0.1
89 0.08
90 0.07
91 0.07
92 0.07
93 0.08
94 0.07
95 0.08
96 0.08
97 0.08
98 0.08
99 0.08
100 0.08
101 0.06
102 0.07
103 0.06
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.07
113 0.08
114 0.09
115 0.09
116 0.15
117 0.16
118 0.16
119 0.17
120 0.16
121 0.18
122 0.2
123 0.21
124 0.15
125 0.15
126 0.15
127 0.13
128 0.13
129 0.09
130 0.06
131 0.05
132 0.04
133 0.03
134 0.03
135 0.03
136 0.03
137 0.04
138 0.04
139 0.05
140 0.05
141 0.06
142 0.06
143 0.07
144 0.08
145 0.09
146 0.08
147 0.1
148 0.11
149 0.12
150 0.14
151 0.14
152 0.14
153 0.15
154 0.17
155 0.22
156 0.22
157 0.26
158 0.25
159 0.25
160 0.23
161 0.23
162 0.23
163 0.17
164 0.15
165 0.12
166 0.14
167 0.14
168 0.13
169 0.12
170 0.11
171 0.1
172 0.1
173 0.1
174 0.06
175 0.06
176 0.06
177 0.06
178 0.07
179 0.07
180 0.07
181 0.08
182 0.15
183 0.22
184 0.3
185 0.31
186 0.32
187 0.35
188 0.44
189 0.54
190 0.56
191 0.6
192 0.63
193 0.69
194 0.75
195 0.8
196 0.81
197 0.73
198 0.73
199 0.64
200 0.58
201 0.55
202 0.5
203 0.43
204 0.34
205 0.31
206 0.22
207 0.2
208 0.14
209 0.1
210 0.08
211 0.06
212 0.05
213 0.05
214 0.05
215 0.04
216 0.05
217 0.06
218 0.07
219 0.07
220 0.07
221 0.07
222 0.08
223 0.1
224 0.1
225 0.12
226 0.12
227 0.13
228 0.15
229 0.16
230 0.17
231 0.2
232 0.29
233 0.32
234 0.36
235 0.41
236 0.4
237 0.39
238 0.4
239 0.38
240 0.36
241 0.33
242 0.31
243 0.25