Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RQL7

Protein Details
Accession F4RQL7    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
77-103IVTRGKAFTKEKNKKKRGSYRGGIIDTHydrophilic
NLS Segment(s)
PositionSequence
85-94TKEKNKKKRG
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
KEGG mlr:MELLADRAFT_87980  -  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences MKIVQKMKNPRIQEKPHQIQSNEKQNHHQSKEKKSNAPFRRIKAEEIQLDQRVADNSFLAKGGAQGSYGHKAHMDLIVTRGKAFTKEKNKKKRGSYRGGIIDTTSHSIKFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.79
3 0.8
4 0.8
5 0.72
6 0.72
7 0.72
8 0.73
9 0.68
10 0.61
11 0.6
12 0.63
13 0.71
14 0.66
15 0.65
16 0.62
17 0.67
18 0.75
19 0.74
20 0.72
21 0.7
22 0.76
23 0.74
24 0.77
25 0.72
26 0.65
27 0.68
28 0.62
29 0.57
30 0.52
31 0.51
32 0.44
33 0.41
34 0.41
35 0.33
36 0.31
37 0.27
38 0.23
39 0.17
40 0.15
41 0.11
42 0.08
43 0.07
44 0.07
45 0.07
46 0.06
47 0.05
48 0.05
49 0.06
50 0.06
51 0.06
52 0.07
53 0.1
54 0.15
55 0.15
56 0.14
57 0.14
58 0.14
59 0.15
60 0.15
61 0.14
62 0.09
63 0.13
64 0.16
65 0.16
66 0.16
67 0.16
68 0.14
69 0.18
70 0.22
71 0.28
72 0.36
73 0.47
74 0.57
75 0.68
76 0.76
77 0.8
78 0.87
79 0.88
80 0.87
81 0.87
82 0.83
83 0.82
84 0.81
85 0.75
86 0.64
87 0.54
88 0.46
89 0.39
90 0.36
91 0.28