Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2NA41

Protein Details
Accession M2NA41    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
131-152AVKIQEKKRRDQIKAEEERRKABasic
NLS Segment(s)
PositionSequence
137-151KKRRDQIKAEEERRK
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 5
Family & Domain DBs
KEGG bcom:BAUCODRAFT_194891  -  
Amino Acid Sequences MAQTSSRALTSSLDKLTISGKQQKKKQPAESWEDEDSEEDSGTTTPIRPVSSSSYPDAPPPTPSSPSFSPGKGTPYQSFPPADYDESSYTAKGSDERRPDKSTAVASRLIAAGIGQKAPKRTKEQREYDQAVKIQEKKRRDQIKAEEERRKAESERAKQAIWDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.23
4 0.25
5 0.26
6 0.31
7 0.38
8 0.45
9 0.54
10 0.63
11 0.71
12 0.76
13 0.79
14 0.79
15 0.78
16 0.79
17 0.76
18 0.72
19 0.64
20 0.55
21 0.46
22 0.37
23 0.3
24 0.22
25 0.16
26 0.1
27 0.09
28 0.08
29 0.08
30 0.07
31 0.07
32 0.09
33 0.11
34 0.11
35 0.11
36 0.14
37 0.2
38 0.24
39 0.26
40 0.26
41 0.28
42 0.27
43 0.29
44 0.3
45 0.24
46 0.22
47 0.25
48 0.25
49 0.25
50 0.25
51 0.29
52 0.27
53 0.29
54 0.29
55 0.24
56 0.24
57 0.22
58 0.25
59 0.23
60 0.25
61 0.23
62 0.26
63 0.27
64 0.27
65 0.27
66 0.22
67 0.23
68 0.21
69 0.2
70 0.16
71 0.17
72 0.16
73 0.18
74 0.17
75 0.14
76 0.12
77 0.12
78 0.11
79 0.12
80 0.15
81 0.18
82 0.27
83 0.31
84 0.36
85 0.39
86 0.4
87 0.38
88 0.38
89 0.38
90 0.32
91 0.31
92 0.28
93 0.24
94 0.24
95 0.22
96 0.19
97 0.13
98 0.09
99 0.1
100 0.09
101 0.1
102 0.1
103 0.12
104 0.19
105 0.23
106 0.29
107 0.35
108 0.44
109 0.54
110 0.62
111 0.69
112 0.71
113 0.77
114 0.77
115 0.72
116 0.68
117 0.6
118 0.55
119 0.52
120 0.52
121 0.49
122 0.51
123 0.53
124 0.55
125 0.63
126 0.68
127 0.67
128 0.69
129 0.72
130 0.76
131 0.8
132 0.82
133 0.8
134 0.74
135 0.74
136 0.67
137 0.61
138 0.52
139 0.51
140 0.52
141 0.52
142 0.58
143 0.57
144 0.54