Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2N364

Protein Details
Accession M2N364    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
123-147RSEQTHRKKRTISKKPPRAAPKRQQBasic
NLS Segment(s)
PositionSequence
128-147HRKKRTISKKPPRAAPKRQQ
Subcellular Location(s) nucl 14, mito 8, cyto 4
Family & Domain DBs
KEGG bcom:BAUCODRAFT_574484  -  
Amino Acid Sequences MGFHYAHIVVDGEVCPAMQPYEVVFRRSRYNLHTISSCLSEQALSYRIMKVDLLPAGSPPSVASQGYHCAATVSKFTEQCALHETSFSTSRTDGWLVRSGVAMSNPQNLAQRLSAKSSDESMRSEQTHRKKRTISKKPPRAAPKRQQPAKASTMDQGQESRQQACTWLGSARHGIQTAIDYIDDAQTGFWRAMVGYNRAVQRQNGNEATAKWVEVHVELARMTADAEVLLKCQRLAGVASQLLELVNGPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.09
5 0.07
6 0.07
7 0.08
8 0.19
9 0.21
10 0.25
11 0.27
12 0.29
13 0.36
14 0.38
15 0.41
16 0.37
17 0.44
18 0.43
19 0.44
20 0.44
21 0.39
22 0.38
23 0.37
24 0.31
25 0.23
26 0.2
27 0.16
28 0.14
29 0.14
30 0.14
31 0.13
32 0.14
33 0.15
34 0.15
35 0.16
36 0.16
37 0.14
38 0.16
39 0.16
40 0.16
41 0.14
42 0.14
43 0.16
44 0.15
45 0.14
46 0.11
47 0.12
48 0.12
49 0.12
50 0.12
51 0.12
52 0.15
53 0.16
54 0.16
55 0.13
56 0.12
57 0.13
58 0.14
59 0.14
60 0.13
61 0.16
62 0.16
63 0.17
64 0.23
65 0.23
66 0.22
67 0.25
68 0.25
69 0.21
70 0.21
71 0.21
72 0.17
73 0.2
74 0.19
75 0.16
76 0.13
77 0.14
78 0.16
79 0.17
80 0.15
81 0.15
82 0.21
83 0.2
84 0.2
85 0.2
86 0.18
87 0.16
88 0.16
89 0.15
90 0.1
91 0.13
92 0.13
93 0.14
94 0.16
95 0.16
96 0.17
97 0.16
98 0.19
99 0.17
100 0.19
101 0.19
102 0.18
103 0.18
104 0.18
105 0.19
106 0.16
107 0.17
108 0.17
109 0.19
110 0.19
111 0.22
112 0.26
113 0.34
114 0.43
115 0.45
116 0.48
117 0.51
118 0.59
119 0.67
120 0.72
121 0.73
122 0.74
123 0.81
124 0.81
125 0.83
126 0.84
127 0.82
128 0.81
129 0.8
130 0.79
131 0.8
132 0.8
133 0.78
134 0.72
135 0.69
136 0.63
137 0.56
138 0.47
139 0.38
140 0.36
141 0.3
142 0.27
143 0.22
144 0.19
145 0.22
146 0.22
147 0.21
148 0.19
149 0.18
150 0.19
151 0.19
152 0.18
153 0.14
154 0.15
155 0.14
156 0.15
157 0.17
158 0.17
159 0.17
160 0.17
161 0.16
162 0.14
163 0.14
164 0.13
165 0.11
166 0.09
167 0.08
168 0.08
169 0.08
170 0.08
171 0.07
172 0.06
173 0.06
174 0.08
175 0.07
176 0.07
177 0.07
178 0.07
179 0.12
180 0.15
181 0.17
182 0.19
183 0.24
184 0.26
185 0.28
186 0.3
187 0.28
188 0.32
189 0.33
190 0.38
191 0.35
192 0.35
193 0.34
194 0.33
195 0.36
196 0.29
197 0.25
198 0.18
199 0.17
200 0.16
201 0.14
202 0.17
203 0.12
204 0.13
205 0.13
206 0.13
207 0.12
208 0.11
209 0.11
210 0.08
211 0.07
212 0.06
213 0.07
214 0.07
215 0.09
216 0.11
217 0.11
218 0.11
219 0.12
220 0.12
221 0.12
222 0.14
223 0.16
224 0.2
225 0.22
226 0.22
227 0.21
228 0.21
229 0.19
230 0.17