Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2MU93

Protein Details
Accession M2MU93    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
139-158IIRKDSKKAHRSPHLNKRHLBasic
NLS Segment(s)
PositionSequence
145-147KKA
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013226  Pal1  
KEGG bcom:BAUCODRAFT_157635  -  
Pfam View protein in Pfam  
PF08316  Pal1  
Amino Acid Sequences MATGSSKEAQAYLIDPLNAPEPSAETGPGSHFRSTFDSKQPTTTTTSTTSPRTSLSTNNPFRDTATSTTQKQATATTSEAFPSYRTEAFGDHNTTRRHAPPPYEDGKAGASSGPSSGRRRTSSLKERFPGDDSTRPLDIIRKDSKKAHRSPHLNKRHLPGPDVIDRLDPALGGRAYHHEGPYDAATLARNMDSKTSPIAALQTTNEEALKATPAENIKDAVERHQPLDGVAIVPPGMPDRFGRTYDYEEGTDMMREGPMDGPGYKQWAGKDYDPTDLKGQSEPTYSLDRALQAHTINDNGIEMEDRADRMRDYRTAERKGTLDTRDPVEIAGDDGKYVDMEYAAYKNDRENEENVQRSGSLRAAGASLKKRIGSLRHRKDHDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.17
4 0.21
5 0.19
6 0.18
7 0.14
8 0.14
9 0.17
10 0.18
11 0.17
12 0.13
13 0.15
14 0.19
15 0.24
16 0.25
17 0.25
18 0.24
19 0.27
20 0.33
21 0.39
22 0.41
23 0.44
24 0.49
25 0.48
26 0.53
27 0.52
28 0.48
29 0.47
30 0.43
31 0.38
32 0.33
33 0.36
34 0.35
35 0.37
36 0.37
37 0.32
38 0.32
39 0.31
40 0.3
41 0.32
42 0.38
43 0.44
44 0.5
45 0.53
46 0.53
47 0.5
48 0.5
49 0.47
50 0.41
51 0.35
52 0.35
53 0.36
54 0.36
55 0.41
56 0.41
57 0.38
58 0.34
59 0.32
60 0.27
61 0.25
62 0.25
63 0.2
64 0.19
65 0.19
66 0.19
67 0.17
68 0.15
69 0.15
70 0.17
71 0.16
72 0.17
73 0.17
74 0.18
75 0.22
76 0.26
77 0.27
78 0.27
79 0.32
80 0.32
81 0.34
82 0.36
83 0.36
84 0.37
85 0.36
86 0.39
87 0.38
88 0.44
89 0.46
90 0.44
91 0.4
92 0.36
93 0.34
94 0.28
95 0.22
96 0.15
97 0.12
98 0.1
99 0.11
100 0.13
101 0.16
102 0.19
103 0.24
104 0.29
105 0.32
106 0.36
107 0.41
108 0.48
109 0.54
110 0.59
111 0.62
112 0.59
113 0.59
114 0.57
115 0.53
116 0.49
117 0.44
118 0.4
119 0.36
120 0.37
121 0.34
122 0.32
123 0.3
124 0.29
125 0.26
126 0.28
127 0.33
128 0.33
129 0.36
130 0.44
131 0.53
132 0.57
133 0.62
134 0.64
135 0.64
136 0.7
137 0.77
138 0.8
139 0.81
140 0.78
141 0.74
142 0.7
143 0.66
144 0.57
145 0.5
146 0.42
147 0.36
148 0.35
149 0.32
150 0.28
151 0.23
152 0.21
153 0.2
154 0.16
155 0.11
156 0.06
157 0.08
158 0.08
159 0.07
160 0.08
161 0.1
162 0.13
163 0.15
164 0.15
165 0.12
166 0.12
167 0.14
168 0.14
169 0.12
170 0.09
171 0.08
172 0.08
173 0.08
174 0.08
175 0.07
176 0.08
177 0.07
178 0.09
179 0.09
180 0.09
181 0.1
182 0.1
183 0.1
184 0.09
185 0.1
186 0.09
187 0.09
188 0.09
189 0.09
190 0.09
191 0.09
192 0.09
193 0.08
194 0.08
195 0.07
196 0.08
197 0.06
198 0.06
199 0.09
200 0.1
201 0.11
202 0.12
203 0.12
204 0.12
205 0.14
206 0.14
207 0.15
208 0.21
209 0.21
210 0.21
211 0.21
212 0.21
213 0.18
214 0.19
215 0.16
216 0.09
217 0.08
218 0.08
219 0.06
220 0.06
221 0.06
222 0.06
223 0.06
224 0.06
225 0.07
226 0.13
227 0.16
228 0.17
229 0.2
230 0.21
231 0.26
232 0.28
233 0.3
234 0.24
235 0.22
236 0.21
237 0.18
238 0.16
239 0.12
240 0.09
241 0.07
242 0.06
243 0.07
244 0.07
245 0.07
246 0.09
247 0.09
248 0.1
249 0.11
250 0.15
251 0.15
252 0.17
253 0.17
254 0.2
255 0.24
256 0.25
257 0.32
258 0.29
259 0.35
260 0.34
261 0.35
262 0.34
263 0.32
264 0.3
265 0.25
266 0.25
267 0.2
268 0.21
269 0.2
270 0.2
271 0.24
272 0.23
273 0.22
274 0.21
275 0.21
276 0.2
277 0.2
278 0.2
279 0.16
280 0.18
281 0.17
282 0.17
283 0.15
284 0.13
285 0.12
286 0.09
287 0.09
288 0.08
289 0.07
290 0.08
291 0.09
292 0.1
293 0.11
294 0.12
295 0.12
296 0.14
297 0.18
298 0.2
299 0.26
300 0.35
301 0.43
302 0.48
303 0.5
304 0.51
305 0.49
306 0.5
307 0.5
308 0.45
309 0.43
310 0.4
311 0.4
312 0.38
313 0.37
314 0.31
315 0.26
316 0.21
317 0.17
318 0.16
319 0.13
320 0.11
321 0.11
322 0.11
323 0.1
324 0.1
325 0.08
326 0.05
327 0.06
328 0.08
329 0.1
330 0.12
331 0.14
332 0.14
333 0.19
334 0.25
335 0.29
336 0.31
337 0.33
338 0.39
339 0.47
340 0.51
341 0.47
342 0.42
343 0.38
344 0.35
345 0.35
346 0.28
347 0.2
348 0.16
349 0.16
350 0.16
351 0.19
352 0.25
353 0.28
354 0.31
355 0.33
356 0.33
357 0.35
358 0.4
359 0.46
360 0.5
361 0.56
362 0.62
363 0.69