Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4SCG0

Protein Details
Accession F4SCG0    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MARYKLDIQKRQHRERAQPLQRERLGHydrophilic
32-61KDYVKRARDYHSKQDRIKKLREKAALKNPDBasic
NLS Segment(s)
PositionSequence
49-50KK
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007144  SSU_processome_Utp11  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
KEGG mlr:MELLADRAFT_84556  -  
Pfam View protein in Pfam  
PF03998  Utp11  
Amino Acid Sequences MARYKLDIQKRQHRERAQPLQRERLGLLEKHKDYVKRARDYHSKQDRIKKLREKAALKNPDEFYFEMIKSSTEKGVHVRSRGNKALDNDLVVLLKTQDFNYVKTCRAIEEKKVNKIREQLGSMVNAISPDDSEHDEIRNEILKFIQQDTTAISAANKEDDGSAEEDNSTLSASGKKTIFVDSVEEVRNFEQIRNKKRKSSISSSQRNLPIASTSTSHSSTRSVKHKSGSTSTNDTETDLAEQKLEADRHMRKLLGNLKSRLTRLRTLQKAERELELKRALMGNGSKFLKNSVQKKKALPSGRDLSWYDKLDRNDLIEEQDEKERLAKLNEGIKTGATVWKWKAERKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.88
4 0.86
5 0.86
6 0.84
7 0.84
8 0.78
9 0.71
10 0.6
11 0.56
12 0.52
13 0.46
14 0.46
15 0.46
16 0.44
17 0.46
18 0.5
19 0.46
20 0.48
21 0.54
22 0.56
23 0.55
24 0.58
25 0.63
26 0.69
27 0.72
28 0.76
29 0.77
30 0.77
31 0.75
32 0.81
33 0.83
34 0.81
35 0.84
36 0.82
37 0.81
38 0.81
39 0.82
40 0.78
41 0.78
42 0.8
43 0.8
44 0.72
45 0.71
46 0.64
47 0.57
48 0.53
49 0.44
50 0.37
51 0.32
52 0.3
53 0.23
54 0.21
55 0.2
56 0.19
57 0.2
58 0.2
59 0.16
60 0.18
61 0.22
62 0.3
63 0.34
64 0.35
65 0.41
66 0.44
67 0.51
68 0.55
69 0.53
70 0.49
71 0.47
72 0.5
73 0.44
74 0.38
75 0.31
76 0.26
77 0.23
78 0.18
79 0.15
80 0.09
81 0.09
82 0.09
83 0.08
84 0.16
85 0.17
86 0.18
87 0.24
88 0.26
89 0.27
90 0.28
91 0.28
92 0.23
93 0.29
94 0.31
95 0.33
96 0.42
97 0.46
98 0.53
99 0.6
100 0.6
101 0.56
102 0.59
103 0.56
104 0.5
105 0.46
106 0.39
107 0.34
108 0.33
109 0.29
110 0.23
111 0.18
112 0.13
113 0.11
114 0.08
115 0.06
116 0.05
117 0.06
118 0.08
119 0.1
120 0.11
121 0.12
122 0.12
123 0.12
124 0.13
125 0.16
126 0.14
127 0.13
128 0.12
129 0.13
130 0.14
131 0.16
132 0.16
133 0.11
134 0.12
135 0.13
136 0.14
137 0.12
138 0.11
139 0.1
140 0.09
141 0.09
142 0.09
143 0.07
144 0.06
145 0.06
146 0.06
147 0.08
148 0.08
149 0.08
150 0.08
151 0.08
152 0.07
153 0.07
154 0.07
155 0.05
156 0.04
157 0.04
158 0.07
159 0.07
160 0.11
161 0.11
162 0.12
163 0.13
164 0.14
165 0.14
166 0.12
167 0.14
168 0.11
169 0.14
170 0.15
171 0.14
172 0.14
173 0.13
174 0.16
175 0.14
176 0.15
177 0.2
178 0.26
179 0.36
180 0.46
181 0.48
182 0.52
183 0.58
184 0.65
185 0.65
186 0.66
187 0.66
188 0.66
189 0.72
190 0.68
191 0.68
192 0.62
193 0.56
194 0.48
195 0.38
196 0.29
197 0.22
198 0.2
199 0.15
200 0.13
201 0.15
202 0.17
203 0.17
204 0.16
205 0.19
206 0.22
207 0.27
208 0.34
209 0.36
210 0.38
211 0.42
212 0.45
213 0.46
214 0.46
215 0.44
216 0.41
217 0.42
218 0.39
219 0.37
220 0.33
221 0.3
222 0.25
223 0.21
224 0.19
225 0.15
226 0.14
227 0.11
228 0.11
229 0.11
230 0.16
231 0.15
232 0.14
233 0.19
234 0.23
235 0.28
236 0.3
237 0.3
238 0.26
239 0.33
240 0.4
241 0.41
242 0.45
243 0.43
244 0.46
245 0.49
246 0.5
247 0.49
248 0.46
249 0.44
250 0.45
251 0.52
252 0.53
253 0.57
254 0.62
255 0.63
256 0.64
257 0.6
258 0.56
259 0.49
260 0.44
261 0.44
262 0.39
263 0.32
264 0.27
265 0.27
266 0.23
267 0.24
268 0.27
269 0.22
270 0.26
271 0.28
272 0.28
273 0.26
274 0.29
275 0.33
276 0.37
277 0.45
278 0.5
279 0.55
280 0.6
281 0.66
282 0.71
283 0.71
284 0.72
285 0.66
286 0.63
287 0.62
288 0.58
289 0.57
290 0.51
291 0.48
292 0.47
293 0.46
294 0.42
295 0.41
296 0.42
297 0.42
298 0.41
299 0.38
300 0.33
301 0.31
302 0.3
303 0.28
304 0.28
305 0.26
306 0.3
307 0.27
308 0.25
309 0.27
310 0.26
311 0.26
312 0.27
313 0.28
314 0.28
315 0.35
316 0.37
317 0.36
318 0.33
319 0.31
320 0.29
321 0.27
322 0.27
323 0.21
324 0.26
325 0.26
326 0.35
327 0.39