Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2N7W0

Protein Details
Accession M2N7W0    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
154-175VDEVSRKEYLRKNRRRPVEDTVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 9, nucl 5.5, mito 5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039205  NDUFA11  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0032981  P:mitochondrial respiratory chain complex I assembly  
KEGG bcom:BAUCODRAFT_572453  -  
Amino Acid Sequences MAFPPPSQDQIQNIYQPKDAVGAAIQATGITAAGGTFLAAIQNTMARQNVGAMGAFSRFGTTIAVYAAMGGAYEFTKNASANLRQRDDAWNPAIGGGFAGMMLGLSCMTDCRDGYSDIRSAPAVVGYGAGLSAILYAFSYTGGTLNGYQRDPEVDEVSRKEYLRKNRRRPVEDTVNEIGEGRGVYGPGYEERRAQRIKDAYGIDVPRRGVEAAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.36
4 0.33
5 0.29
6 0.25
7 0.18
8 0.13
9 0.13
10 0.12
11 0.11
12 0.1
13 0.08
14 0.08
15 0.07
16 0.06
17 0.04
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.04
26 0.04
27 0.05
28 0.05
29 0.06
30 0.07
31 0.09
32 0.09
33 0.09
34 0.09
35 0.1
36 0.1
37 0.09
38 0.09
39 0.07
40 0.07
41 0.08
42 0.08
43 0.07
44 0.07
45 0.06
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.06
54 0.05
55 0.04
56 0.04
57 0.03
58 0.04
59 0.03
60 0.04
61 0.04
62 0.05
63 0.06
64 0.07
65 0.08
66 0.11
67 0.17
68 0.23
69 0.29
70 0.31
71 0.3
72 0.32
73 0.35
74 0.34
75 0.33
76 0.28
77 0.22
78 0.2
79 0.2
80 0.18
81 0.13
82 0.1
83 0.06
84 0.04
85 0.03
86 0.03
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.03
96 0.05
97 0.05
98 0.07
99 0.08
100 0.1
101 0.11
102 0.13
103 0.14
104 0.13
105 0.14
106 0.12
107 0.11
108 0.09
109 0.09
110 0.06
111 0.05
112 0.05
113 0.04
114 0.04
115 0.03
116 0.03
117 0.03
118 0.02
119 0.02
120 0.02
121 0.02
122 0.02
123 0.03
124 0.03
125 0.03
126 0.04
127 0.03
128 0.04
129 0.04
130 0.05
131 0.08
132 0.11
133 0.13
134 0.13
135 0.13
136 0.13
137 0.15
138 0.16
139 0.16
140 0.16
141 0.15
142 0.18
143 0.2
144 0.23
145 0.25
146 0.24
147 0.28
148 0.32
149 0.41
150 0.5
151 0.59
152 0.66
153 0.72
154 0.82
155 0.81
156 0.8
157 0.79
158 0.79
159 0.71
160 0.67
161 0.61
162 0.51
163 0.45
164 0.4
165 0.3
166 0.19
167 0.17
168 0.11
169 0.08
170 0.08
171 0.07
172 0.08
173 0.1
174 0.13
175 0.18
176 0.18
177 0.24
178 0.27
179 0.36
180 0.38
181 0.38
182 0.43
183 0.44
184 0.46
185 0.47
186 0.45
187 0.4
188 0.44
189 0.47
190 0.41
191 0.39
192 0.37
193 0.31
194 0.31