Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2MME2

Protein Details
Accession M2MME2   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
44-71SSNKSAPATKIKRKKKASRTHHSGRSNTHydrophilic
NLS Segment(s)
PositionSequence
17-64NRHPARRAQANGRSKDLVLLKAGRKRPSSNKSAPATKIKRKKKASRTH
129-137KQSKAIGKS
Subcellular Location(s) nucl 15, cyto_nucl 11.333, mito_nucl 10.833, cyto 6.5, mito 5.5
Family & Domain DBs
KEGG bcom:BAUCODRAFT_570024  -  
Amino Acid Sequences MVATTRSKADGKAATANRHPARRAQANGRSKDLVLLKAGRKRPSSNKSAPATKIKRKKKASRTHHSGRSNTKTVELVRGSGAADTLMTTNVSDEVADESNINGSSHSEPQKRLARGILVHTKGASKVHKQSKAIGKSRKVSWKPDVYSPVSRIPENKKQLVRLLEQMWWEKQLSDARHSDRVARGRTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.56
4 0.55
5 0.56
6 0.54
7 0.51
8 0.55
9 0.57
10 0.59
11 0.58
12 0.62
13 0.66
14 0.69
15 0.67
16 0.6
17 0.52
18 0.51
19 0.44
20 0.36
21 0.3
22 0.32
23 0.33
24 0.39
25 0.45
26 0.45
27 0.46
28 0.51
29 0.58
30 0.59
31 0.63
32 0.63
33 0.66
34 0.66
35 0.68
36 0.66
37 0.66
38 0.67
39 0.68
40 0.7
41 0.71
42 0.75
43 0.79
44 0.85
45 0.85
46 0.87
47 0.88
48 0.88
49 0.88
50 0.87
51 0.86
52 0.83
53 0.78
54 0.76
55 0.73
56 0.66
57 0.57
58 0.5
59 0.43
60 0.37
61 0.37
62 0.28
63 0.22
64 0.18
65 0.17
66 0.16
67 0.13
68 0.12
69 0.06
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.06
83 0.06
84 0.06
85 0.06
86 0.07
87 0.07
88 0.07
89 0.05
90 0.07
91 0.09
92 0.13
93 0.2
94 0.21
95 0.22
96 0.29
97 0.37
98 0.36
99 0.35
100 0.32
101 0.29
102 0.28
103 0.33
104 0.34
105 0.28
106 0.27
107 0.26
108 0.25
109 0.24
110 0.26
111 0.24
112 0.22
113 0.3
114 0.38
115 0.43
116 0.44
117 0.5
118 0.56
119 0.62
120 0.65
121 0.64
122 0.62
123 0.62
124 0.67
125 0.7
126 0.65
127 0.63
128 0.63
129 0.64
130 0.6
131 0.61
132 0.61
133 0.56
134 0.57
135 0.53
136 0.52
137 0.45
138 0.43
139 0.43
140 0.45
141 0.49
142 0.51
143 0.56
144 0.52
145 0.53
146 0.59
147 0.58
148 0.53
149 0.5
150 0.45
151 0.4
152 0.4
153 0.41
154 0.36
155 0.33
156 0.3
157 0.24
158 0.26
159 0.3
160 0.3
161 0.32
162 0.37
163 0.4
164 0.46
165 0.47
166 0.48
167 0.49
168 0.53