Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2NDZ8

Protein Details
Accession M2NDZ8    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
57-79ILTPPPSKGKGRKRRPEQDVDTDHydrophilic
NLS Segment(s)
PositionSequence
29-42KATGPKAKSTKSKK
62-71PSKGKGRKRR
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
KEGG bcom:BAUCODRAFT_439310  -  
Amino Acid Sequences MTGVTAKSIKHRISKIRTAGKDIGPTTSKATGPKAKSTKSKKVAGTPASDKDDVEAILTPPPSKGKGRKRRPEQDVDTDGEGEVEGLSKKVKIEVGEDIGEGLRQANPAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.7
3 0.72
4 0.69
5 0.69
6 0.67
7 0.6
8 0.58
9 0.5
10 0.45
11 0.37
12 0.36
13 0.32
14 0.3
15 0.28
16 0.24
17 0.29
18 0.32
19 0.33
20 0.41
21 0.43
22 0.45
23 0.53
24 0.6
25 0.64
26 0.63
27 0.67
28 0.61
29 0.63
30 0.66
31 0.59
32 0.56
33 0.5
34 0.47
35 0.44
36 0.41
37 0.33
38 0.26
39 0.23
40 0.18
41 0.14
42 0.1
43 0.06
44 0.08
45 0.08
46 0.08
47 0.08
48 0.09
49 0.11
50 0.16
51 0.25
52 0.34
53 0.45
54 0.56
55 0.66
56 0.75
57 0.82
58 0.85
59 0.86
60 0.81
61 0.79
62 0.72
63 0.64
64 0.55
65 0.45
66 0.38
67 0.28
68 0.21
69 0.12
70 0.08
71 0.06
72 0.05
73 0.05
74 0.06
75 0.07
76 0.08
77 0.1
78 0.13
79 0.13
80 0.16
81 0.2
82 0.23
83 0.23
84 0.23
85 0.21
86 0.19
87 0.18
88 0.15
89 0.11
90 0.08