Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2N897

Protein Details
Accession M2N897   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-34VDRIVPPISRRQPQRRKHSHPLSPLKYCLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
KEGG bcom:BAUCODRAFT_25148  -  
Amino Acid Sequences MLVRPVDRIVPPISRRQPQRRKHSHPLSPLKYCLPITPLPPHPPALIQPNPTSTGMMPSCTHKHTRTPWPSTGPVVICPGERTCRYCTGAEERTFDHKLAHNLRKHVFEVHTDGGRLDYAGVEVMMYRFVLSRPSGVESGGEFWGVKVDVSRPASKARAGRAGVMQGEDLPEVNEQSEEEATDVKREGEAAVSSPGKLVNGKAEGIREGGEKPAKVSKMKLKSSCPAPIDTAKAQSPRLQRSGGDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.62
3 0.69
4 0.76
5 0.77
6 0.85
7 0.86
8 0.88
9 0.91
10 0.91
11 0.88
12 0.89
13 0.9
14 0.86
15 0.8
16 0.74
17 0.66
18 0.6
19 0.52
20 0.44
21 0.38
22 0.33
23 0.32
24 0.36
25 0.39
26 0.4
27 0.42
28 0.41
29 0.37
30 0.36
31 0.35
32 0.36
33 0.34
34 0.33
35 0.33
36 0.33
37 0.35
38 0.34
39 0.32
40 0.23
41 0.25
42 0.22
43 0.22
44 0.21
45 0.23
46 0.26
47 0.28
48 0.33
49 0.28
50 0.36
51 0.4
52 0.5
53 0.54
54 0.58
55 0.59
56 0.6
57 0.6
58 0.54
59 0.51
60 0.4
61 0.33
62 0.29
63 0.25
64 0.19
65 0.19
66 0.19
67 0.19
68 0.2
69 0.22
70 0.23
71 0.27
72 0.3
73 0.29
74 0.3
75 0.33
76 0.38
77 0.37
78 0.36
79 0.33
80 0.36
81 0.36
82 0.32
83 0.27
84 0.23
85 0.28
86 0.35
87 0.4
88 0.38
89 0.42
90 0.44
91 0.44
92 0.42
93 0.38
94 0.31
95 0.25
96 0.27
97 0.24
98 0.23
99 0.2
100 0.19
101 0.16
102 0.14
103 0.12
104 0.07
105 0.04
106 0.04
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.04
116 0.04
117 0.06
118 0.06
119 0.07
120 0.08
121 0.11
122 0.11
123 0.11
124 0.11
125 0.09
126 0.11
127 0.1
128 0.1
129 0.07
130 0.07
131 0.08
132 0.07
133 0.07
134 0.05
135 0.06
136 0.12
137 0.15
138 0.17
139 0.18
140 0.21
141 0.23
142 0.26
143 0.28
144 0.26
145 0.3
146 0.29
147 0.3
148 0.28
149 0.29
150 0.25
151 0.22
152 0.19
153 0.12
154 0.12
155 0.1
156 0.09
157 0.07
158 0.07
159 0.06
160 0.07
161 0.06
162 0.06
163 0.07
164 0.07
165 0.07
166 0.07
167 0.09
168 0.09
169 0.11
170 0.11
171 0.1
172 0.1
173 0.1
174 0.1
175 0.09
176 0.1
177 0.09
178 0.14
179 0.14
180 0.14
181 0.14
182 0.14
183 0.13
184 0.13
185 0.13
186 0.14
187 0.16
188 0.17
189 0.18
190 0.19
191 0.19
192 0.19
193 0.19
194 0.15
195 0.14
196 0.19
197 0.21
198 0.2
199 0.22
200 0.28
201 0.31
202 0.32
203 0.38
204 0.42
205 0.48
206 0.56
207 0.6
208 0.6
209 0.64
210 0.68
211 0.69
212 0.62
213 0.56
214 0.52
215 0.5
216 0.5
217 0.45
218 0.43
219 0.4
220 0.41
221 0.4
222 0.42
223 0.46
224 0.47
225 0.49
226 0.46