Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2MK94

Protein Details
Accession M2MK94    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
37-57GSGAVDRKRRRSHRVAQQQCAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
KEGG bcom:BAUCODRAFT_303094  -  
Amino Acid Sequences MILSRSSARCQDTMTRCTRSGAVATIRRAINFPRLDGSGAVDRKRRRSHRVAQQQCAGPALSSLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.44
4 0.45
5 0.42
6 0.34
7 0.29
8 0.26
9 0.27
10 0.27
11 0.27
12 0.31
13 0.3
14 0.28
15 0.28
16 0.26
17 0.27
18 0.22
19 0.22
20 0.18
21 0.19
22 0.19
23 0.18
24 0.19
25 0.18
26 0.2
27 0.22
28 0.26
29 0.29
30 0.37
31 0.46
32 0.51
33 0.53
34 0.6
35 0.67
36 0.73
37 0.81
38 0.82
39 0.79
40 0.79
41 0.75
42 0.66
43 0.58
44 0.47
45 0.36