Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2N2U1

Protein Details
Accession M2N2U1    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
89-109TPNAVRPSKARKPKTEPPSKPHydrophilic
NLS Segment(s)
PositionSequence
77-116AAKAIRSKRQPPTPNAVRPSKARKPKTEPPSKPTPEPSRH
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
KEGG bcom:BAUCODRAFT_26609  -  
Amino Acid Sequences MQTGSATQYFREAVTRPSQYDSHRAGPSEGILKTIMGLRGLSISDESVFDFEAPDGCKDWPGTRYGPDSPHLQFAKAAKAIRSKRQPPTPNAVRPSKARKPKTEPPSKPTPEPSRHHLPVPKREAALHLLTLPGELRDAIYDLLAIHDGPLYAQIRGVWKPSANGKRRHALAYRRFPQEPSASLANRQLRKEVLSVFYGANRFIYQHSTVAGMRSMISPAAQTIWKFHCTATNHLRHIQLRFDCRGSRWQITYTLRKLADGVITIENSLTDSDYCTCLEDDATEITLECAKDTTDLAVLLSSLCARRRARLDAFAKVEGDSTMYRMPTAFCMTCSKPHVPLVSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.32
4 0.36
5 0.4
6 0.4
7 0.48
8 0.48
9 0.47
10 0.46
11 0.45
12 0.42
13 0.39
14 0.38
15 0.35
16 0.29
17 0.23
18 0.21
19 0.19
20 0.18
21 0.21
22 0.19
23 0.13
24 0.13
25 0.12
26 0.13
27 0.13
28 0.13
29 0.1
30 0.1
31 0.1
32 0.1
33 0.1
34 0.09
35 0.1
36 0.09
37 0.09
38 0.08
39 0.11
40 0.12
41 0.12
42 0.14
43 0.14
44 0.16
45 0.17
46 0.2
47 0.19
48 0.22
49 0.23
50 0.25
51 0.3
52 0.32
53 0.33
54 0.32
55 0.35
56 0.32
57 0.38
58 0.35
59 0.3
60 0.3
61 0.29
62 0.33
63 0.32
64 0.32
65 0.28
66 0.37
67 0.41
68 0.47
69 0.56
70 0.57
71 0.62
72 0.7
73 0.74
74 0.71
75 0.77
76 0.76
77 0.74
78 0.73
79 0.7
80 0.63
81 0.62
82 0.66
83 0.65
84 0.65
85 0.65
86 0.67
87 0.7
88 0.77
89 0.8
90 0.82
91 0.79
92 0.75
93 0.79
94 0.74
95 0.69
96 0.68
97 0.67
98 0.64
99 0.62
100 0.63
101 0.61
102 0.59
103 0.6
104 0.57
105 0.56
106 0.57
107 0.59
108 0.56
109 0.47
110 0.45
111 0.43
112 0.4
113 0.34
114 0.25
115 0.18
116 0.15
117 0.14
118 0.13
119 0.11
120 0.07
121 0.05
122 0.05
123 0.04
124 0.04
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.04
134 0.04
135 0.04
136 0.04
137 0.07
138 0.08
139 0.08
140 0.08
141 0.09
142 0.12
143 0.12
144 0.14
145 0.12
146 0.12
147 0.14
148 0.22
149 0.31
150 0.35
151 0.42
152 0.44
153 0.48
154 0.49
155 0.52
156 0.49
157 0.49
158 0.51
159 0.54
160 0.56
161 0.55
162 0.54
163 0.51
164 0.49
165 0.42
166 0.34
167 0.28
168 0.26
169 0.22
170 0.23
171 0.29
172 0.31
173 0.32
174 0.31
175 0.28
176 0.25
177 0.26
178 0.27
179 0.23
180 0.18
181 0.16
182 0.17
183 0.15
184 0.16
185 0.15
186 0.14
187 0.12
188 0.1
189 0.1
190 0.09
191 0.13
192 0.12
193 0.12
194 0.12
195 0.14
196 0.14
197 0.14
198 0.13
199 0.1
200 0.09
201 0.09
202 0.09
203 0.07
204 0.07
205 0.06
206 0.06
207 0.07
208 0.08
209 0.08
210 0.12
211 0.15
212 0.17
213 0.18
214 0.18
215 0.22
216 0.24
217 0.32
218 0.37
219 0.41
220 0.42
221 0.45
222 0.49
223 0.46
224 0.45
225 0.45
226 0.4
227 0.38
228 0.39
229 0.38
230 0.36
231 0.35
232 0.41
233 0.39
234 0.39
235 0.36
236 0.35
237 0.39
238 0.44
239 0.5
240 0.45
241 0.46
242 0.42
243 0.4
244 0.38
245 0.33
246 0.28
247 0.2
248 0.2
249 0.15
250 0.15
251 0.15
252 0.14
253 0.12
254 0.11
255 0.1
256 0.08
257 0.06
258 0.08
259 0.09
260 0.11
261 0.11
262 0.12
263 0.12
264 0.12
265 0.12
266 0.1
267 0.1
268 0.1
269 0.11
270 0.09
271 0.09
272 0.09
273 0.12
274 0.12
275 0.1
276 0.09
277 0.09
278 0.1
279 0.1
280 0.11
281 0.09
282 0.1
283 0.1
284 0.09
285 0.09
286 0.08
287 0.08
288 0.09
289 0.11
290 0.13
291 0.21
292 0.22
293 0.29
294 0.34
295 0.42
296 0.45
297 0.52
298 0.54
299 0.55
300 0.59
301 0.54
302 0.49
303 0.41
304 0.37
305 0.27
306 0.25
307 0.17
308 0.16
309 0.17
310 0.16
311 0.16
312 0.16
313 0.17
314 0.18
315 0.24
316 0.22
317 0.21
318 0.28
319 0.31
320 0.37
321 0.42
322 0.42
323 0.4
324 0.45