Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2N7I4

Protein Details
Accession M2N7I4    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
47-76RMRMHRQRTQQPHPHHRRRCTVHRRKVEDABasic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 3.5, cyto_nucl 3.5, cyto 2.5
Family & Domain DBs
KEGG bcom:BAUCODRAFT_560453  -  
Amino Acid Sequences MFRQAMQPDLSSVINLVLVIRTTLRLCRHALPSRTALIYMPVRVIVRMRMHRQRTQQPHPHHRRRCTVHRRKVEDAAGYAVSATLITAATVTGVARRQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.06
5 0.06
6 0.06
7 0.06
8 0.08
9 0.09
10 0.14
11 0.17
12 0.19
13 0.22
14 0.26
15 0.34
16 0.4
17 0.42
18 0.41
19 0.41
20 0.4
21 0.38
22 0.33
23 0.25
24 0.22
25 0.2
26 0.16
27 0.13
28 0.13
29 0.12
30 0.12
31 0.13
32 0.13
33 0.17
34 0.21
35 0.27
36 0.34
37 0.39
38 0.44
39 0.51
40 0.56
41 0.59
42 0.64
43 0.67
44 0.68
45 0.74
46 0.8
47 0.83
48 0.82
49 0.81
50 0.81
51 0.8
52 0.81
53 0.82
54 0.82
55 0.82
56 0.83
57 0.84
58 0.8
59 0.78
60 0.71
61 0.63
62 0.53
63 0.46
64 0.36
65 0.28
66 0.23
67 0.16
68 0.12
69 0.08
70 0.06
71 0.04
72 0.03
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.07