Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2N380

Protein Details
Accession M2N380    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MEKMSYVRRRRRMSQAGREYWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
KEGG bcom:BAUCODRAFT_229455  -  
Amino Acid Sequences MEKMSYVRRRRRMSQAGREYWIVCLPRGALGVELPALAFSKAYNHLRSRGLVNTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.77
4 0.72
5 0.67
6 0.56
7 0.47
8 0.4
9 0.3
10 0.2
11 0.16
12 0.13
13 0.12
14 0.12
15 0.11
16 0.07
17 0.06
18 0.07
19 0.06
20 0.06
21 0.05
22 0.04
23 0.05
24 0.05
25 0.05
26 0.04
27 0.08
28 0.15
29 0.19
30 0.25
31 0.28
32 0.32
33 0.35
34 0.37
35 0.38