Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2LB96

Protein Details
Accession M2LB96    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-47LSLGNRWRGRPKRQGQHRLKPAPRKKSTKRERRRARLLMABasic
NLS Segment(s)
PositionSequence
13-43RWRGRPKRQGQHRLKPAPRKKSTKRERRRAR
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7
Family & Domain DBs
KEGG bcom:BAUCODRAFT_39221  -  
Amino Acid Sequences MNDPPPILSLGNRWRGRPKRQGQHRLKPAPRKKSTKRERRRARLLMAEAVMVANTLRDSGIDMFGDTDMDTFHDNDMDLLDDNPGSARTPGIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.57
3 0.65
4 0.68
5 0.7
6 0.71
7 0.8
8 0.88
9 0.87
10 0.9
11 0.91
12 0.9
13 0.88
14 0.88
15 0.87
16 0.86
17 0.85
18 0.84
19 0.83
20 0.84
21 0.87
22 0.87
23 0.89
24 0.89
25 0.91
26 0.91
27 0.91
28 0.86
29 0.8
30 0.75
31 0.66
32 0.57
33 0.47
34 0.36
35 0.26
36 0.2
37 0.15
38 0.08
39 0.05
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.05
46 0.06
47 0.07
48 0.07
49 0.07
50 0.08
51 0.08
52 0.08
53 0.06
54 0.06
55 0.05
56 0.06
57 0.07
58 0.07
59 0.07
60 0.08
61 0.08
62 0.08
63 0.08
64 0.09
65 0.08
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.09
72 0.09
73 0.09