Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2N5I6

Protein Details
Accession M2N5I6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
229-250NWYVYVKRKDDKQRSDGRDWLPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, mito 5, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR023271  Aquaporin-like  
IPR000292  For/NO2_transpt  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
KEGG bcom:BAUCODRAFT_123949  -  
Pfam View protein in Pfam  
PF01226  Form_Nir_trans  
Amino Acid Sequences MGLCFLKNVYGGLLLSAGGELSLALGMGFPNVTNNDLGLMRLLQGITFPIGLVIVYFLGAELYTGYGMWFAMTALSRRGKPTQYIRAIIASLLGNYLGAFLWATLQSYLTETLTEEPWRGRIISSVDSDFTDNQFHIIFLRSIGCGFLVTIAMLMGTQNRDGISKALGLHLPFFISTVLQFPHTVESMYMGTTGMLLGSRLTVWKFLWKCLLPVILGNAVGGAFTGAYNWYVYVKRKDDKQRSDGRDWLPVSSDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.06
5 0.04
6 0.04
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.04
15 0.04
16 0.04
17 0.07
18 0.08
19 0.1
20 0.1
21 0.1
22 0.11
23 0.12
24 0.12
25 0.1
26 0.09
27 0.09
28 0.1
29 0.1
30 0.07
31 0.07
32 0.08
33 0.08
34 0.08
35 0.07
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.03
45 0.04
46 0.04
47 0.04
48 0.03
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.03
58 0.05
59 0.06
60 0.07
61 0.11
62 0.15
63 0.16
64 0.19
65 0.23
66 0.24
67 0.3
68 0.38
69 0.43
70 0.45
71 0.46
72 0.44
73 0.41
74 0.39
75 0.32
76 0.25
77 0.15
78 0.1
79 0.08
80 0.07
81 0.05
82 0.05
83 0.06
84 0.03
85 0.03
86 0.03
87 0.03
88 0.04
89 0.04
90 0.05
91 0.05
92 0.05
93 0.06
94 0.07
95 0.08
96 0.07
97 0.07
98 0.07
99 0.08
100 0.09
101 0.09
102 0.09
103 0.08
104 0.09
105 0.1
106 0.1
107 0.08
108 0.1
109 0.12
110 0.14
111 0.15
112 0.15
113 0.15
114 0.15
115 0.16
116 0.14
117 0.12
118 0.1
119 0.08
120 0.08
121 0.08
122 0.07
123 0.07
124 0.08
125 0.07
126 0.07
127 0.08
128 0.07
129 0.07
130 0.07
131 0.07
132 0.05
133 0.05
134 0.05
135 0.04
136 0.04
137 0.04
138 0.03
139 0.03
140 0.03
141 0.03
142 0.04
143 0.05
144 0.05
145 0.06
146 0.06
147 0.07
148 0.08
149 0.08
150 0.08
151 0.09
152 0.09
153 0.1
154 0.12
155 0.11
156 0.12
157 0.11
158 0.1
159 0.09
160 0.09
161 0.07
162 0.06
163 0.06
164 0.07
165 0.08
166 0.09
167 0.09
168 0.09
169 0.12
170 0.12
171 0.12
172 0.1
173 0.11
174 0.11
175 0.1
176 0.1
177 0.08
178 0.07
179 0.07
180 0.07
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.05
187 0.06
188 0.07
189 0.09
190 0.1
191 0.19
192 0.2
193 0.22
194 0.3
195 0.29
196 0.29
197 0.31
198 0.32
199 0.24
200 0.24
201 0.25
202 0.18
203 0.18
204 0.16
205 0.12
206 0.1
207 0.1
208 0.08
209 0.05
210 0.03
211 0.03
212 0.04
213 0.05
214 0.06
215 0.06
216 0.07
217 0.09
218 0.13
219 0.2
220 0.28
221 0.34
222 0.39
223 0.49
224 0.59
225 0.67
226 0.73
227 0.77
228 0.79
229 0.8
230 0.81
231 0.8
232 0.72
233 0.7
234 0.62
235 0.54