Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2N6B0

Protein Details
Accession M2N6B0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
106-126MLPLRLPHRQHHHECRRVPRQBasic
NLS Segment(s)
Subcellular Location(s) mito 7extr 7, plas 5, vacu 3, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
KEGG bcom:BAUCODRAFT_342491  -  
Amino Acid Sequences MDTVCLALTVSQLEEVTMAAATTVRPALASSALPAAHARAPLLLRLAPVPLPDFRAVRAVCQTMLLAALMADTVGLAPIVFPLVEENMAAVQMGGLAAAPAPLVPMLPLRLPHRQHHHECRRVPRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.06
5 0.05
6 0.04
7 0.05
8 0.05
9 0.06
10 0.06
11 0.05
12 0.05
13 0.06
14 0.07
15 0.08
16 0.09
17 0.08
18 0.1
19 0.1
20 0.11
21 0.11
22 0.11
23 0.11
24 0.11
25 0.1
26 0.1
27 0.11
28 0.11
29 0.13
30 0.11
31 0.1
32 0.1
33 0.11
34 0.09
35 0.1
36 0.11
37 0.1
38 0.12
39 0.13
40 0.13
41 0.13
42 0.19
43 0.18
44 0.17
45 0.19
46 0.17
47 0.15
48 0.15
49 0.14
50 0.08
51 0.09
52 0.07
53 0.04
54 0.03
55 0.03
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.03
67 0.02
68 0.03
69 0.03
70 0.04
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.04
78 0.03
79 0.03
80 0.03
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.03
89 0.03
90 0.03
91 0.04
92 0.06
93 0.08
94 0.1
95 0.14
96 0.18
97 0.27
98 0.32
99 0.4
100 0.48
101 0.56
102 0.64
103 0.72
104 0.78
105 0.79
106 0.82