Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2MWI2

Protein Details
Accession M2MWI2    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
93-112EIFVRAKRRNAHPRINADDFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 9.833, mito 7, cyto 6.5, cyto_pero 4.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
KEGG bcom:BAUCODRAFT_152792  -  
Pfam View protein in Pfam  
PF14560  Ubiquitin_2  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
CDD cd17039  Ubl_ubiquitin_like  
Amino Acid Sequences MANPLPVRVIVTGNLFPPHNDRYTFSKTDTVLQVKQRISEMERVPPERMELHKMTGQPPFGLMMADHRTLASYGVRPGNVLQVFFYVHEDGDEIFVRAKRRNAHPRINADDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.2
4 0.23
5 0.25
6 0.24
7 0.24
8 0.26
9 0.31
10 0.37
11 0.39
12 0.36
13 0.37
14 0.35
15 0.38
16 0.4
17 0.37
18 0.35
19 0.37
20 0.41
21 0.37
22 0.37
23 0.34
24 0.3
25 0.28
26 0.31
27 0.28
28 0.28
29 0.32
30 0.33
31 0.33
32 0.31
33 0.3
34 0.25
35 0.25
36 0.24
37 0.21
38 0.21
39 0.23
40 0.24
41 0.24
42 0.24
43 0.22
44 0.16
45 0.15
46 0.14
47 0.11
48 0.1
49 0.08
50 0.09
51 0.12
52 0.12
53 0.12
54 0.11
55 0.12
56 0.12
57 0.13
58 0.1
59 0.09
60 0.12
61 0.14
62 0.14
63 0.14
64 0.14
65 0.2
66 0.19
67 0.18
68 0.15
69 0.14
70 0.15
71 0.15
72 0.17
73 0.11
74 0.1
75 0.1
76 0.1
77 0.09
78 0.11
79 0.11
80 0.09
81 0.12
82 0.15
83 0.18
84 0.22
85 0.28
86 0.33
87 0.43
88 0.54
89 0.6
90 0.68
91 0.73
92 0.77