Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2NIA1

Protein Details
Accession M2NIA1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
44-71FYVSCIYFHRRRKVKKGRYPGGPKPFIHHydrophilic
NLS Segment(s)
PositionSequence
53-66RRRKVKKGRYPGGP
Subcellular Location(s) plas 13, mito 6, E.R. 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
KEGG bcom:BAUCODRAFT_56137  -  
Pfam View protein in Pfam  
PF01679  Pmp3  
Amino Acid Sequences ICLMVINVFFPPLSVAMLCGLDWDCILNCILLVCAILPSHVHAFYVSCIYFHRRRKVKKGRYPGGPKPFIHSSNVLNGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.09
5 0.09
6 0.09
7 0.09
8 0.08
9 0.08
10 0.08
11 0.07
12 0.07
13 0.08
14 0.06
15 0.05
16 0.05
17 0.05
18 0.04
19 0.04
20 0.03
21 0.04
22 0.04
23 0.04
24 0.04
25 0.05
26 0.07
27 0.07
28 0.07
29 0.06
30 0.07
31 0.08
32 0.1
33 0.09
34 0.08
35 0.09
36 0.15
37 0.23
38 0.3
39 0.39
40 0.46
41 0.54
42 0.65
43 0.75
44 0.8
45 0.83
46 0.86
47 0.85
48 0.87
49 0.88
50 0.87
51 0.86
52 0.82
53 0.72
54 0.68
55 0.67
56 0.58
57 0.53
58 0.47
59 0.39