Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2N6N6

Protein Details
Accession M2N6N6    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MNRPRNRQPRPPRDNNVRASAGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019240  DUF2196  
KEGG bcom:BAUCODRAFT_124066  -  
Pfam View protein in Pfam  
PF09962  DUF2196  
Amino Acid Sequences MNRPRNRQPRPPRDNNVRASAGQGSQSAFGNVPSVAQVVRGAAVSIVLKADQPTGREVQGVVQDLLTRGNHPRGIKVRLQDGRIGRVQRMANAAQVVNSHGLTPMGERLNHALEHLEPDPYRSVHGDVSGRPPRILRMEKDARVLDAEFPSEPPARSLAAYFPDSDDGGATVSQSVTATCPICGNFEGDEVAVSRHVDTHVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.86
3 0.81
4 0.74
5 0.64
6 0.56
7 0.49
8 0.4
9 0.32
10 0.27
11 0.21
12 0.19
13 0.19
14 0.17
15 0.13
16 0.12
17 0.12
18 0.1
19 0.1
20 0.09
21 0.09
22 0.07
23 0.08
24 0.08
25 0.07
26 0.08
27 0.07
28 0.07
29 0.06
30 0.07
31 0.07
32 0.06
33 0.06
34 0.06
35 0.07
36 0.07
37 0.11
38 0.11
39 0.12
40 0.15
41 0.17
42 0.17
43 0.17
44 0.17
45 0.16
46 0.18
47 0.19
48 0.16
49 0.14
50 0.14
51 0.14
52 0.16
53 0.13
54 0.11
55 0.12
56 0.15
57 0.19
58 0.19
59 0.25
60 0.28
61 0.33
62 0.34
63 0.34
64 0.39
65 0.4
66 0.41
67 0.39
68 0.36
69 0.35
70 0.35
71 0.34
72 0.26
73 0.28
74 0.27
75 0.23
76 0.25
77 0.21
78 0.18
79 0.18
80 0.18
81 0.12
82 0.12
83 0.12
84 0.09
85 0.09
86 0.08
87 0.06
88 0.07
89 0.06
90 0.06
91 0.09
92 0.09
93 0.09
94 0.09
95 0.11
96 0.12
97 0.12
98 0.12
99 0.09
100 0.08
101 0.12
102 0.12
103 0.12
104 0.1
105 0.12
106 0.14
107 0.13
108 0.14
109 0.12
110 0.13
111 0.12
112 0.15
113 0.15
114 0.14
115 0.23
116 0.28
117 0.28
118 0.27
119 0.26
120 0.27
121 0.33
122 0.36
123 0.3
124 0.33
125 0.4
126 0.42
127 0.47
128 0.44
129 0.37
130 0.34
131 0.32
132 0.25
133 0.19
134 0.18
135 0.13
136 0.14
137 0.17
138 0.17
139 0.17
140 0.15
141 0.15
142 0.15
143 0.15
144 0.15
145 0.14
146 0.16
147 0.17
148 0.17
149 0.16
150 0.17
151 0.17
152 0.16
153 0.13
154 0.09
155 0.09
156 0.09
157 0.08
158 0.07
159 0.06
160 0.07
161 0.07
162 0.07
163 0.07
164 0.11
165 0.11
166 0.11
167 0.14
168 0.14
169 0.16
170 0.17
171 0.18
172 0.15
173 0.15
174 0.16
175 0.13
176 0.14
177 0.12
178 0.12
179 0.11
180 0.11
181 0.1
182 0.11