Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2LET1

Protein Details
Accession M2LET1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-25AQMRACHSRRRVVRRPWIRCGLGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
KEGG bcom:BAUCODRAFT_293837  -  
Amino Acid Sequences MLAQMRACHSRRRVVRRPWIRCGLGPASPSEGASTCHRQRLSVEPQAFFAALTQALRSPYVVSFNQGDYVQCATPPDVASCRRRGAGKSLTACRDLHATRTRLQLRDRKAGVGQAHLCAIREFVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.8
3 0.82
4 0.85
5 0.84
6 0.83
7 0.76
8 0.67
9 0.63
10 0.56
11 0.49
12 0.42
13 0.34
14 0.3
15 0.27
16 0.26
17 0.2
18 0.17
19 0.16
20 0.2
21 0.27
22 0.25
23 0.31
24 0.31
25 0.3
26 0.32
27 0.38
28 0.4
29 0.4
30 0.41
31 0.35
32 0.36
33 0.36
34 0.33
35 0.25
36 0.17
37 0.1
38 0.07
39 0.07
40 0.06
41 0.06
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.11
48 0.11
49 0.12
50 0.12
51 0.12
52 0.13
53 0.13
54 0.12
55 0.1
56 0.12
57 0.1
58 0.09
59 0.1
60 0.09
61 0.1
62 0.11
63 0.11
64 0.12
65 0.17
66 0.22
67 0.25
68 0.26
69 0.27
70 0.29
71 0.29
72 0.33
73 0.35
74 0.38
75 0.41
76 0.45
77 0.45
78 0.46
79 0.44
80 0.37
81 0.36
82 0.3
83 0.31
84 0.33
85 0.33
86 0.34
87 0.44
88 0.48
89 0.47
90 0.54
91 0.55
92 0.54
93 0.61
94 0.59
95 0.53
96 0.49
97 0.51
98 0.45
99 0.45
100 0.4
101 0.32
102 0.33
103 0.31
104 0.3
105 0.23