Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2LVW4

Protein Details
Accession M2LVW4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
186-212KMWEVLCAWRKRRRAKRKVKLGMTVWFHydrophilic
NLS Segment(s)
PositionSequence
195-205RKRRRAKRKVK
Subcellular Location(s) nucl 11, mito 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001810  F-box_dom  
KEGG bcom:BAUCODRAFT_145833  -  
Pfam View protein in Pfam  
PF12937  F-box-like  
Amino Acid Sequences MSQSSASGIDSAAQTQLSSKTSTNLLHLPNEVLLQVLQEIVPDPPKGEHSAFASLLRDTNHISLEYLEYMRIAAVSKRFRQLARDAFFNTYMALLRICLYAPLDDDPIRQAVKRDSRVETSLDRYSIFRTRLQRLHLHMEVWWTEYVHEGVELLKYALRKYPSLMEVQLDVTMIELKEDGAEIACKMWEVLCAWRKRRRAKRKVKLGMTVWFDDKRLTYHAYGAVTVKDLRKPRNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.15
4 0.14
5 0.16
6 0.16
7 0.18
8 0.22
9 0.23
10 0.25
11 0.27
12 0.28
13 0.28
14 0.29
15 0.27
16 0.24
17 0.23
18 0.19
19 0.14
20 0.11
21 0.09
22 0.08
23 0.07
24 0.06
25 0.05
26 0.06
27 0.07
28 0.1
29 0.1
30 0.11
31 0.12
32 0.14
33 0.18
34 0.18
35 0.19
36 0.2
37 0.24
38 0.23
39 0.24
40 0.22
41 0.19
42 0.2
43 0.18
44 0.17
45 0.15
46 0.15
47 0.15
48 0.14
49 0.14
50 0.13
51 0.13
52 0.13
53 0.12
54 0.1
55 0.09
56 0.09
57 0.08
58 0.07
59 0.07
60 0.08
61 0.14
62 0.2
63 0.23
64 0.27
65 0.29
66 0.3
67 0.33
68 0.39
69 0.41
70 0.38
71 0.39
72 0.37
73 0.36
74 0.36
75 0.31
76 0.24
77 0.15
78 0.13
79 0.1
80 0.08
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.07
89 0.08
90 0.09
91 0.09
92 0.1
93 0.1
94 0.11
95 0.11
96 0.11
97 0.11
98 0.16
99 0.22
100 0.27
101 0.3
102 0.31
103 0.33
104 0.34
105 0.35
106 0.3
107 0.28
108 0.24
109 0.21
110 0.2
111 0.17
112 0.19
113 0.21
114 0.21
115 0.22
116 0.25
117 0.31
118 0.34
119 0.37
120 0.39
121 0.38
122 0.43
123 0.39
124 0.34
125 0.29
126 0.28
127 0.24
128 0.21
129 0.18
130 0.11
131 0.1
132 0.11
133 0.1
134 0.08
135 0.07
136 0.06
137 0.06
138 0.06
139 0.06
140 0.05
141 0.06
142 0.07
143 0.08
144 0.12
145 0.13
146 0.14
147 0.15
148 0.2
149 0.2
150 0.22
151 0.23
152 0.2
153 0.19
154 0.19
155 0.17
156 0.12
157 0.1
158 0.08
159 0.09
160 0.07
161 0.07
162 0.06
163 0.06
164 0.06
165 0.06
166 0.06
167 0.05
168 0.05
169 0.05
170 0.06
171 0.06
172 0.06
173 0.06
174 0.06
175 0.07
176 0.08
177 0.17
178 0.24
179 0.32
180 0.39
181 0.48
182 0.56
183 0.65
184 0.75
185 0.78
186 0.82
187 0.86
188 0.89
189 0.93
190 0.94
191 0.91
192 0.88
193 0.82
194 0.78
195 0.72
196 0.65
197 0.58
198 0.49
199 0.42
200 0.35
201 0.31
202 0.26
203 0.24
204 0.25
205 0.22
206 0.24
207 0.28
208 0.27
209 0.27
210 0.26
211 0.23
212 0.22
213 0.24
214 0.24
215 0.27
216 0.33