Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2LV01

Protein Details
Accession M2LV01   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-24GYIKDARKTKVRNRLRSIRVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
KEGG bcom:BAUCODRAFT_32483  -  
Amino Acid Sequences MCDSGYIKDARKTKVRNRLRSIRVTFFDTRPASKDSYHPGNDRVGRLYQPLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.7
3 0.74
4 0.77
5 0.81
6 0.79
7 0.8
8 0.76
9 0.71
10 0.63
11 0.59
12 0.53
13 0.43
14 0.44
15 0.36
16 0.32
17 0.29
18 0.29
19 0.25
20 0.24
21 0.27
22 0.26
23 0.33
24 0.36
25 0.36
26 0.36
27 0.42
28 0.45
29 0.43
30 0.4
31 0.35
32 0.32