Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2LRP2

Protein Details
Accession M2LRP2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
16-37LNAVPKKKTSHMKKRHRQMAGKBasic
NLS Segment(s)
PositionSequence
21-33KKKTSHMKKRHRQ
Subcellular Location(s) mito 13cyto 13cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG bcom:BAUCODRAFT_47702  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences LSPIPGLLGELWEGLLNAVPKKKTSHMKKRHRQMAGKALKDVTALNKCSACGRVKRAHVLCPYCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.08
3 0.08
4 0.1
5 0.14
6 0.15
7 0.16
8 0.19
9 0.26
10 0.34
11 0.44
12 0.52
13 0.6
14 0.7
15 0.78
16 0.85
17 0.87
18 0.84
19 0.79
20 0.75
21 0.75
22 0.71
23 0.63
24 0.55
25 0.46
26 0.39
27 0.34
28 0.28
29 0.24
30 0.22
31 0.22
32 0.23
33 0.23
34 0.23
35 0.24
36 0.28
37 0.27
38 0.28
39 0.34
40 0.4
41 0.45
42 0.54
43 0.55
44 0.59
45 0.62