Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2MK59

Protein Details
Accession M2MK59   
Localization Confidence High
Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-48PLSINFQRHHQRHCKRYWLKNGPRSPLPPHydrophilic
148-167RPQPPRLTRRHPLRNQHPHSBasic
NLS Segment(s)
PositionSequence
87-124RRRNPSRPQHPGAPRAHPYQPRPHHFPPQPPRKPLLPH
141-162HALRRLPRPQPPRLTRRHPLRN
Subcellular Location(s) nucl 12, mito 11, plas 3
Family & Domain DBs
KEGG bcom:BAUCODRAFT_301986  -  
Amino Acid Sequences MNTHSQLVAMLLAATDHKKPLSINFQRHHQRHCKRYWLKNGPRSPLPPQQRAKLDRQRTRLLLALCSSIDLALLPDKQDHINQNGPRRRNPSRPQHPGAPRAHPYQPRPHHFPPQPPRKPLLPHHHHEHHPPPALHPQTHHALRRLPRPQPPRLTRRHPLRNQHPHSPPRPTRLHVLQSGHRPIHPSPTRTLETTNPVLPPPKHRPHIPTQPSHRLPQTSHGDYEVSQKRLLLHLQPSRPWCSHRTALPLPRRSAQHAHGQLQEYDSRAAGCRRRGTPLALGSLRRHRHAQGYFRPRGVAQVCGGIHGWENSYAWGGEGEDFEQVWWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.13
4 0.13
5 0.15
6 0.16
7 0.24
8 0.33
9 0.4
10 0.48
11 0.51
12 0.6
13 0.69
14 0.73
15 0.76
16 0.75
17 0.76
18 0.76
19 0.79
20 0.81
21 0.8
22 0.85
23 0.87
24 0.87
25 0.87
26 0.87
27 0.88
28 0.84
29 0.81
30 0.76
31 0.72
32 0.71
33 0.69
34 0.68
35 0.66
36 0.67
37 0.69
38 0.7
39 0.73
40 0.73
41 0.75
42 0.74
43 0.75
44 0.75
45 0.68
46 0.65
47 0.6
48 0.51
49 0.44
50 0.37
51 0.32
52 0.24
53 0.22
54 0.19
55 0.14
56 0.12
57 0.08
58 0.08
59 0.08
60 0.09
61 0.09
62 0.1
63 0.12
64 0.13
65 0.17
66 0.2
67 0.22
68 0.3
69 0.34
70 0.43
71 0.49
72 0.52
73 0.55
74 0.59
75 0.61
76 0.64
77 0.69
78 0.7
79 0.74
80 0.79
81 0.77
82 0.79
83 0.78
84 0.76
85 0.72
86 0.67
87 0.61
88 0.57
89 0.58
90 0.55
91 0.54
92 0.55
93 0.59
94 0.59
95 0.63
96 0.63
97 0.66
98 0.65
99 0.7
100 0.7
101 0.72
102 0.73
103 0.68
104 0.67
105 0.62
106 0.64
107 0.62
108 0.63
109 0.59
110 0.57
111 0.61
112 0.63
113 0.6
114 0.61
115 0.57
116 0.53
117 0.52
118 0.46
119 0.41
120 0.44
121 0.45
122 0.39
123 0.34
124 0.31
125 0.31
126 0.36
127 0.35
128 0.29
129 0.32
130 0.36
131 0.43
132 0.46
133 0.45
134 0.49
135 0.53
136 0.58
137 0.62
138 0.66
139 0.66
140 0.67
141 0.69
142 0.69
143 0.73
144 0.75
145 0.73
146 0.75
147 0.77
148 0.8
149 0.78
150 0.78
151 0.75
152 0.72
153 0.69
154 0.69
155 0.62
156 0.58
157 0.56
158 0.5
159 0.48
160 0.46
161 0.46
162 0.41
163 0.41
164 0.38
165 0.41
166 0.44
167 0.39
168 0.34
169 0.33
170 0.28
171 0.35
172 0.35
173 0.31
174 0.29
175 0.34
176 0.36
177 0.33
178 0.35
179 0.28
180 0.29
181 0.29
182 0.28
183 0.22
184 0.22
185 0.26
186 0.24
187 0.3
188 0.34
189 0.39
190 0.41
191 0.44
192 0.49
193 0.53
194 0.63
195 0.62
196 0.61
197 0.62
198 0.68
199 0.67
200 0.65
201 0.6
202 0.52
203 0.46
204 0.46
205 0.46
206 0.38
207 0.36
208 0.33
209 0.3
210 0.28
211 0.36
212 0.34
213 0.28
214 0.25
215 0.26
216 0.26
217 0.27
218 0.29
219 0.25
220 0.27
221 0.32
222 0.35
223 0.39
224 0.42
225 0.45
226 0.44
227 0.43
228 0.38
229 0.38
230 0.39
231 0.38
232 0.42
233 0.45
234 0.52
235 0.58
236 0.61
237 0.58
238 0.59
239 0.57
240 0.55
241 0.53
242 0.47
243 0.48
244 0.48
245 0.49
246 0.48
247 0.48
248 0.43
249 0.4
250 0.38
251 0.29
252 0.24
253 0.2
254 0.16
255 0.16
256 0.22
257 0.25
258 0.31
259 0.36
260 0.37
261 0.44
262 0.45
263 0.47
264 0.48
265 0.46
266 0.47
267 0.43
268 0.45
269 0.44
270 0.51
271 0.5
272 0.47
273 0.46
274 0.42
275 0.48
276 0.52
277 0.56
278 0.57
279 0.64
280 0.66
281 0.63
282 0.62
283 0.53
284 0.53
285 0.45
286 0.38
287 0.29
288 0.31
289 0.29
290 0.29
291 0.29
292 0.21
293 0.21
294 0.18
295 0.19
296 0.13
297 0.14
298 0.13
299 0.14
300 0.13
301 0.12
302 0.12
303 0.11
304 0.11
305 0.12
306 0.12
307 0.11
308 0.11