Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2MY92

Protein Details
Accession M2MY92   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
83-111KTGRARAKKASASKKARRKYKKLAEEQEGBasic
NLS Segment(s)
PositionSequence
83-104KTGRARAKKASASKKARRKYKK
Subcellular Location(s) nucl 19, cyto_nucl 13.333, mito_nucl 11.999, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
KEGG bcom:BAUCODRAFT_47992  -  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences ALPPRPKIVETDITESFLKGSGPGGQKINKTSSAVQIKHIPTGIVVKSQETRSRELNRKFARQLLAEKLDQLENGDQSRTAIKTGRARAKKASASKKARRKYKKLAEEQEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.35
3 0.29
4 0.2
5 0.16
6 0.1
7 0.1
8 0.14
9 0.16
10 0.19
11 0.23
12 0.26
13 0.29
14 0.32
15 0.35
16 0.31
17 0.31
18 0.29
19 0.34
20 0.39
21 0.37
22 0.36
23 0.4
24 0.38
25 0.37
26 0.35
27 0.26
28 0.19
29 0.22
30 0.19
31 0.15
32 0.15
33 0.14
34 0.17
35 0.19
36 0.24
37 0.22
38 0.24
39 0.27
40 0.35
41 0.42
42 0.44
43 0.51
44 0.5
45 0.53
46 0.52
47 0.5
48 0.45
49 0.39
50 0.38
51 0.34
52 0.34
53 0.28
54 0.28
55 0.25
56 0.22
57 0.2
58 0.18
59 0.13
60 0.12
61 0.12
62 0.12
63 0.11
64 0.11
65 0.14
66 0.12
67 0.13
68 0.13
69 0.19
70 0.26
71 0.35
72 0.44
73 0.47
74 0.5
75 0.55
76 0.6
77 0.62
78 0.65
79 0.67
80 0.67
81 0.72
82 0.79
83 0.83
84 0.84
85 0.87
86 0.88
87 0.87
88 0.88
89 0.89
90 0.89
91 0.9