Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2MIY3

Protein Details
Accession M2MIY3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
194-213GVNGSARRTRHKRSNTQTGMHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 24, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007277  Svp26/Tex261  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016020  C:membrane  
GO:0097020  F:COPII receptor activity  
GO:0006888  P:endoplasmic reticulum to Golgi vesicle-mediated transport  
KEGG bcom:BAUCODRAFT_127145  -  
Pfam View protein in Pfam  
PF04148  Erv26  
Amino Acid Sequences MWVLPLLGYLGLALGFLFLTLAIASGLYYLSELVEEHAVPAKKILTRLIYVVIGLQILLAVVDRFPVTLSALSIGSHVVYMQNLRRFPIVKLTDPIFISSCALVILNHWLWFRHFSAPPANADRYNYYAQANIPTFTEVASFFGLNVWLVPFALFVSLSAGENVLPSMGSEYATGQGSSFISPGQEPNTGGPMGVNGSARRTRHKRSNTQTGMAKAAVNSVREWAGETGELLGFWRGERTRPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.03
6 0.04
7 0.03
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.05
19 0.05
20 0.06
21 0.08
22 0.07
23 0.08
24 0.14
25 0.15
26 0.15
27 0.16
28 0.18
29 0.19
30 0.21
31 0.24
32 0.21
33 0.22
34 0.24
35 0.24
36 0.21
37 0.19
38 0.18
39 0.14
40 0.1
41 0.08
42 0.07
43 0.04
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.06
55 0.07
56 0.07
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.06
63 0.06
64 0.06
65 0.05
66 0.05
67 0.08
68 0.13
69 0.17
70 0.18
71 0.19
72 0.21
73 0.22
74 0.22
75 0.29
76 0.28
77 0.25
78 0.28
79 0.29
80 0.3
81 0.28
82 0.29
83 0.2
84 0.17
85 0.16
86 0.12
87 0.1
88 0.07
89 0.07
90 0.06
91 0.05
92 0.09
93 0.08
94 0.1
95 0.1
96 0.11
97 0.11
98 0.14
99 0.16
100 0.17
101 0.17
102 0.17
103 0.22
104 0.23
105 0.25
106 0.26
107 0.26
108 0.22
109 0.22
110 0.22
111 0.2
112 0.2
113 0.19
114 0.15
115 0.15
116 0.15
117 0.18
118 0.17
119 0.14
120 0.13
121 0.12
122 0.12
123 0.11
124 0.11
125 0.07
126 0.08
127 0.08
128 0.07
129 0.06
130 0.07
131 0.07
132 0.06
133 0.06
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.05
144 0.06
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.04
152 0.04
153 0.03
154 0.05
155 0.05
156 0.06
157 0.06
158 0.07
159 0.09
160 0.1
161 0.1
162 0.08
163 0.09
164 0.09
165 0.09
166 0.09
167 0.07
168 0.07
169 0.08
170 0.1
171 0.11
172 0.13
173 0.13
174 0.14
175 0.17
176 0.16
177 0.15
178 0.14
179 0.12
180 0.11
181 0.12
182 0.12
183 0.1
184 0.15
185 0.21
186 0.22
187 0.32
188 0.38
189 0.45
190 0.53
191 0.63
192 0.69
193 0.73
194 0.83
195 0.79
196 0.79
197 0.76
198 0.69
199 0.62
200 0.52
201 0.44
202 0.33
203 0.33
204 0.29
205 0.24
206 0.21
207 0.2
208 0.2
209 0.19
210 0.21
211 0.16
212 0.15
213 0.14
214 0.14
215 0.13
216 0.12
217 0.12
218 0.11
219 0.11
220 0.1
221 0.1
222 0.16
223 0.15