Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2M292

Protein Details
Accession M2M292   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
48-67PDGTVKRRRRRVSKDDDGNEBasic
NLS Segment(s)
Subcellular Location(s) mito 6, extr 6, E.R. 6, plas 5, golg 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG bcom:BAUCODRAFT_144769  -  
Amino Acid Sequences MHYLHPRSRTTGTLFTTTLAISFLVVALPHLLPCPVDRRQYADTIEMPDGTVKRRRRRVSKDDDGNEAADEVPLMSQERPKRECPVPKPGGLMGQLMGFEQREQSVPKEVVVRTLSARERGPSIKAGNGEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.34
3 0.32
4 0.27
5 0.22
6 0.15
7 0.11
8 0.07
9 0.07
10 0.06
11 0.05
12 0.05
13 0.05
14 0.06
15 0.06
16 0.06
17 0.07
18 0.07
19 0.07
20 0.09
21 0.14
22 0.16
23 0.21
24 0.22
25 0.27
26 0.3
27 0.33
28 0.33
29 0.31
30 0.28
31 0.26
32 0.26
33 0.2
34 0.18
35 0.17
36 0.16
37 0.16
38 0.22
39 0.26
40 0.35
41 0.44
42 0.52
43 0.59
44 0.68
45 0.75
46 0.78
47 0.8
48 0.8
49 0.73
50 0.69
51 0.6
52 0.51
53 0.41
54 0.31
55 0.21
56 0.11
57 0.09
58 0.05
59 0.03
60 0.03
61 0.05
62 0.05
63 0.1
64 0.14
65 0.2
66 0.24
67 0.27
68 0.33
69 0.39
70 0.47
71 0.48
72 0.55
73 0.53
74 0.51
75 0.51
76 0.46
77 0.42
78 0.34
79 0.29
80 0.18
81 0.15
82 0.13
83 0.11
84 0.11
85 0.08
86 0.07
87 0.07
88 0.08
89 0.09
90 0.11
91 0.13
92 0.19
93 0.19
94 0.21
95 0.26
96 0.25
97 0.29
98 0.28
99 0.28
100 0.24
101 0.3
102 0.31
103 0.3
104 0.32
105 0.28
106 0.31
107 0.32
108 0.33
109 0.33
110 0.32
111 0.33