Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2MJP4

Protein Details
Accession M2MJP4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
68-92TTTNDDSRRSRRRTNRTKPGMRTIRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
KEGG bcom:BAUCODRAFT_295641  -  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MPSPALIARLRHLQESSELLVLSSPAAAAHLRVTRNAVAEEQMQDAVPINERICHACGDLLIPGWTCTTTNDDSRRSRRRTNRTKPGMRTIRCDRCNSTTSLTSAKPSGSQLQGSAIDSTSAMPKPQLPDPPIPAVEVSTRPSRKARNSKSTLQSLLASQQSKNGPSIAKPGLDLMDFMKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.3
4 0.23
5 0.21
6 0.18
7 0.17
8 0.16
9 0.13
10 0.08
11 0.06
12 0.04
13 0.05
14 0.06
15 0.06
16 0.1
17 0.14
18 0.15
19 0.16
20 0.2
21 0.21
22 0.22
23 0.23
24 0.19
25 0.17
26 0.18
27 0.19
28 0.17
29 0.15
30 0.13
31 0.12
32 0.12
33 0.11
34 0.11
35 0.11
36 0.1
37 0.12
38 0.13
39 0.15
40 0.15
41 0.15
42 0.13
43 0.12
44 0.12
45 0.11
46 0.1
47 0.09
48 0.08
49 0.07
50 0.07
51 0.07
52 0.08
53 0.07
54 0.08
55 0.12
56 0.13
57 0.19
58 0.23
59 0.28
60 0.34
61 0.43
62 0.51
63 0.52
64 0.59
65 0.64
66 0.71
67 0.76
68 0.81
69 0.82
70 0.83
71 0.86
72 0.81
73 0.82
74 0.8
75 0.7
76 0.67
77 0.65
78 0.65
79 0.59
80 0.58
81 0.51
82 0.46
83 0.47
84 0.42
85 0.36
86 0.28
87 0.26
88 0.27
89 0.24
90 0.2
91 0.19
92 0.17
93 0.15
94 0.15
95 0.17
96 0.15
97 0.15
98 0.14
99 0.16
100 0.16
101 0.16
102 0.15
103 0.11
104 0.1
105 0.09
106 0.1
107 0.1
108 0.09
109 0.09
110 0.09
111 0.11
112 0.14
113 0.18
114 0.24
115 0.25
116 0.29
117 0.33
118 0.36
119 0.35
120 0.32
121 0.28
122 0.24
123 0.22
124 0.2
125 0.19
126 0.24
127 0.25
128 0.28
129 0.33
130 0.4
131 0.48
132 0.57
133 0.63
134 0.65
135 0.71
136 0.77
137 0.78
138 0.77
139 0.69
140 0.6
141 0.51
142 0.42
143 0.41
144 0.37
145 0.32
146 0.25
147 0.29
148 0.3
149 0.3
150 0.3
151 0.28
152 0.24
153 0.25
154 0.32
155 0.29
156 0.26
157 0.25
158 0.26
159 0.25
160 0.23
161 0.22