Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2N7B8

Protein Details
Accession M2N7B8   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-69FERLLSRRWRKERTGRTFCFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 9.5, cyto_mito 7.5, cyto 4.5
Family & Domain DBs
KEGG bcom:BAUCODRAFT_520196  -  
Amino Acid Sequences MSKVKYGEVCRNGTNEQNAKLNIRSAVIHLETASVSRARMTTCVLALGLFERLLSRRWRKERTGRTFCFRRATSVRSSLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.41
3 0.38
4 0.39
5 0.39
6 0.38
7 0.36
8 0.33
9 0.26
10 0.23
11 0.2
12 0.16
13 0.18
14 0.16
15 0.15
16 0.12
17 0.12
18 0.11
19 0.11
20 0.11
21 0.07
22 0.06
23 0.07
24 0.07
25 0.07
26 0.08
27 0.1
28 0.09
29 0.09
30 0.09
31 0.08
32 0.08
33 0.07
34 0.07
35 0.06
36 0.05
37 0.05
38 0.05
39 0.06
40 0.1
41 0.18
42 0.26
43 0.35
44 0.44
45 0.51
46 0.59
47 0.69
48 0.77
49 0.8
50 0.82
51 0.78
52 0.79
53 0.8
54 0.76
55 0.74
56 0.64
57 0.62
58 0.57
59 0.56
60 0.54