Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2MQ72

Protein Details
Accession M2MQ72    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
346-366LCTYDKVQRVKNKWKCTLKDGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004855  TFIIA_asu/bsu  
IPR009088  TFIIA_b-brl  
Gene Ontology GO:0005672  C:transcription factor TFIIA complex  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
KEGG bcom:BAUCODRAFT_385117  -  
Pfam View protein in Pfam  
PF03153  TFIIA  
CDD cd07976  TFIIA_alpha_beta_like  
Amino Acid Sequences MTNQLVGEIYKKIIEEVVAGSKDQFEESGVSASVLEDLAKEWRTKLSARNVAVMPWDPKAAPPQAQATTASPLPSAANGLPSYPYDGQAGAVNGSTYIKAEPGAEAQYHGLSNGYSREPPPTQGGFARAQQLVQQQQAQRGLALPGQRPQGLQMPTQSAQQYAQQQQQYNMQRQQQALQQQQAQPRIKVENETPQVNQGSYTQQPRPPTATYAQTDGADDALQQWQSQLAQRRAVTAEQTRRADRMMRDQVLQSSADLQSGLMLPLGEQPGLYDRKRRGTAPIASGSKAQSQPSISQLDGDNDFDDDEAKIKDEDDEDAINSDLDSDEDPTGNIGDEEDDLGDTILCTYDKVQRVKNKWKCTLKDGVMSISGKEWVFHKGMGEFEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.15
4 0.2
5 0.2
6 0.2
7 0.2
8 0.2
9 0.2
10 0.19
11 0.16
12 0.11
13 0.12
14 0.13
15 0.15
16 0.13
17 0.13
18 0.12
19 0.12
20 0.11
21 0.09
22 0.08
23 0.06
24 0.07
25 0.11
26 0.13
27 0.14
28 0.15
29 0.18
30 0.22
31 0.25
32 0.32
33 0.38
34 0.44
35 0.45
36 0.5
37 0.47
38 0.45
39 0.45
40 0.41
41 0.33
42 0.26
43 0.26
44 0.2
45 0.21
46 0.26
47 0.27
48 0.26
49 0.27
50 0.31
51 0.31
52 0.33
53 0.33
54 0.29
55 0.29
56 0.26
57 0.24
58 0.18
59 0.17
60 0.16
61 0.14
62 0.14
63 0.11
64 0.13
65 0.13
66 0.13
67 0.14
68 0.14
69 0.19
70 0.17
71 0.18
72 0.15
73 0.15
74 0.16
75 0.16
76 0.16
77 0.11
78 0.1
79 0.09
80 0.09
81 0.09
82 0.08
83 0.07
84 0.07
85 0.07
86 0.07
87 0.08
88 0.08
89 0.09
90 0.11
91 0.11
92 0.11
93 0.12
94 0.12
95 0.12
96 0.11
97 0.09
98 0.07
99 0.08
100 0.1
101 0.11
102 0.12
103 0.12
104 0.18
105 0.19
106 0.21
107 0.26
108 0.24
109 0.25
110 0.24
111 0.28
112 0.24
113 0.25
114 0.28
115 0.22
116 0.21
117 0.22
118 0.26
119 0.25
120 0.24
121 0.27
122 0.25
123 0.29
124 0.31
125 0.28
126 0.23
127 0.21
128 0.2
129 0.17
130 0.19
131 0.16
132 0.17
133 0.2
134 0.2
135 0.19
136 0.2
137 0.24
138 0.23
139 0.22
140 0.21
141 0.23
142 0.24
143 0.26
144 0.24
145 0.19
146 0.18
147 0.2
148 0.24
149 0.23
150 0.28
151 0.29
152 0.29
153 0.3
154 0.37
155 0.39
156 0.39
157 0.4
158 0.39
159 0.39
160 0.39
161 0.4
162 0.35
163 0.38
164 0.35
165 0.33
166 0.33
167 0.33
168 0.37
169 0.43
170 0.41
171 0.34
172 0.33
173 0.32
174 0.29
175 0.27
176 0.24
177 0.25
178 0.26
179 0.27
180 0.25
181 0.25
182 0.25
183 0.23
184 0.21
185 0.13
186 0.14
187 0.15
188 0.2
189 0.2
190 0.22
191 0.25
192 0.26
193 0.29
194 0.26
195 0.27
196 0.25
197 0.27
198 0.26
199 0.26
200 0.25
201 0.22
202 0.21
203 0.18
204 0.15
205 0.1
206 0.08
207 0.07
208 0.07
209 0.07
210 0.07
211 0.07
212 0.07
213 0.08
214 0.12
215 0.19
216 0.2
217 0.25
218 0.25
219 0.27
220 0.28
221 0.28
222 0.28
223 0.28
224 0.32
225 0.34
226 0.37
227 0.36
228 0.35
229 0.36
230 0.37
231 0.32
232 0.35
233 0.36
234 0.35
235 0.35
236 0.36
237 0.36
238 0.33
239 0.3
240 0.2
241 0.15
242 0.13
243 0.12
244 0.11
245 0.09
246 0.08
247 0.08
248 0.08
249 0.06
250 0.05
251 0.05
252 0.08
253 0.09
254 0.08
255 0.07
256 0.08
257 0.13
258 0.18
259 0.19
260 0.22
261 0.26
262 0.34
263 0.37
264 0.38
265 0.39
266 0.43
267 0.48
268 0.47
269 0.51
270 0.45
271 0.44
272 0.44
273 0.39
274 0.38
275 0.34
276 0.29
277 0.24
278 0.24
279 0.25
280 0.27
281 0.28
282 0.22
283 0.22
284 0.22
285 0.22
286 0.21
287 0.21
288 0.17
289 0.14
290 0.14
291 0.12
292 0.12
293 0.09
294 0.09
295 0.09
296 0.1
297 0.09
298 0.1
299 0.12
300 0.12
301 0.13
302 0.14
303 0.14
304 0.13
305 0.14
306 0.14
307 0.12
308 0.11
309 0.1
310 0.07
311 0.07
312 0.08
313 0.09
314 0.09
315 0.1
316 0.1
317 0.1
318 0.1
319 0.1
320 0.09
321 0.07
322 0.07
323 0.07
324 0.08
325 0.07
326 0.07
327 0.07
328 0.07
329 0.07
330 0.06
331 0.06
332 0.06
333 0.06
334 0.07
335 0.09
336 0.17
337 0.24
338 0.3
339 0.37
340 0.46
341 0.56
342 0.66
343 0.74
344 0.76
345 0.79
346 0.84
347 0.82
348 0.79
349 0.8
350 0.74
351 0.72
352 0.64
353 0.57
354 0.52
355 0.48
356 0.41
357 0.33
358 0.31
359 0.23
360 0.22
361 0.2
362 0.19
363 0.2
364 0.21
365 0.22
366 0.2