Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2NGW5

Protein Details
Accession M2NGW5   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
27-54KQCAIPQKFCHPKRKRNRIRVNPWIEHGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
KEGG bcom:BAUCODRAFT_32268  -  
Amino Acid Sequences MGYTWRPSVAGTISLAPMAEILPKSAKQCAIPQKFCHPKRKRNRIRVNPWIEHGTSRIFVHRVCPKRESYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.11
4 0.09
5 0.07
6 0.08
7 0.07
8 0.08
9 0.1
10 0.12
11 0.13
12 0.16
13 0.17
14 0.16
15 0.24
16 0.33
17 0.39
18 0.41
19 0.42
20 0.5
21 0.59
22 0.62
23 0.66
24 0.64
25 0.66
26 0.74
27 0.83
28 0.83
29 0.85
30 0.9
31 0.9
32 0.92
33 0.92
34 0.89
35 0.81
36 0.74
37 0.67
38 0.56
39 0.47
40 0.38
41 0.3
42 0.24
43 0.22
44 0.21
45 0.19
46 0.19
47 0.26
48 0.34
49 0.39
50 0.42
51 0.46